TRAF3 Monoclonal antibody, PBS Only

• 

  WB analysis using 66310-1-Ig (same clone as 66310-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66310-1-Ig (TRAF3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66310-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66310-1-Ig (same clone as 66310-1-PBS)

  WB result of TRAF3 antibody (66310-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRAF3 transfected HEK-293 cells. This data was developed using the same antibody clone with 66310-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66310-1-Ig (same clone as 66310-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66310-1-Ig (TRAF3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66310-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 66310-1-Ig (same clone as 66310-1-PBS)

  LPS treated U-937 cells were subjected to SDS PAGE followed by western blot with 66310-1-Ig (TRAF3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66310-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 66310-1-Ig (same clone as 66310-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66310-1-Ig (TRAF3 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66310-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 66310-1-Ig (same clone as 66310-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66310-1-Ig (TRAF3 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66310-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66310-1-Ig (same clone as 66310-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TRAF3 antibody (66310-1-Ig, Clone: 1E3F4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66310-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRAF3 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66310-1-PBS

Clone No.1E3F4

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CD40 receptor-associated factor 1, CD40 binding protein, CAP-1, CAP1, CAP 1

---

Product Information

66310-1-PBS targets TRAF3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12185

  Product name: Recombinant human TRAF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 6-351 aa of BC075087

  Sequence: KMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMK

• Full Name: TNF receptor-associated factor 3
• Calculated Molecular Weight: 568 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC075087
• Gene Symbol: TRAF3
• Gene ID (NCBI): 7187
• RRID: AB_2881692
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13114
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNF receptor-associated factor 3 (TRAF3) has many alternative names including CAP-1, CD40 receptor-associated factor 1(CRAF1), CD40-binding protein(CD40BP) and LMP1-associated protein 1 (LAP1). TRAF3 regulates pathways leading to the activation of NF-kappa-B and MAP kinases, and plays a central role in the regulation of innate immune response. It modulates signaling pathways leading to the production of cytokines and interferon. As an essential constituent of several E3 ubiquitin-protein ligase complexes, TRAF3 promote 'Lys-63'-linked ubiquitination of target proteins. Moreover, TRAF3 undergoes both 'Lys-48'-linked and 'Lys-63'-linked ubiquitination in response to various stimuli and is deubiquitinated by OTUB1, OTUB2 and OTUD5.