TREM2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68723-1-Ig (same clone as 68723-1-PBS)

  Non-treated and PMA treated THP-1 cellls were subjected to SDS PAGE followed by western blot with 68723-1-Ig (TREM2 antibody) at dilution of 1:5000 incubated at room temperature for 1 hours. This data was developed using the same antibody clone with 68723-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 68723-1-Ig (same clone as 68723-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TREM2 antibody (68723-1-Ig, Clone: 1F4H10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68723-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 68723-1-Ig (same clone as 68723-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using TREM2 antibody (68723-1-Ig, Clone: 1F4H10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68723-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 68723-1-Ig (same clone as 68723-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using TREM2 antibody (68723-1-Ig, Clone: 1F4H10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68723-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 68723-1-Ig (same clone as 68723-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using TREM2 antibody (68723-1-Ig, Clone: 1F4H10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68723-1-PBS in a different storage buffer formulation.

TREM2 Monoclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 68723-1-PBS

Clone No.1F4H10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

Trem2c, Trem2b, Trem2a, TREM-2, TREM 2

---

Product Information

68723-1-PBS targets TREM2 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6843

  Product name: Recombinant human TREM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 22-222 aa of BC032362

  Sequence: TVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRPSQGSHLPSCLSKEPLGRRNPLPTHFHPSPPGLHLSHQDSSSQRPLGCSLAWTEARDTSTQ

• Full Name: triggering receptor expressed on myeloid cells 2
• Calculated Molecular Weight: 222 aa, 25 kDa
• Observed Molecular Weight: 26-32 kDa
• GenBank Accession Number: BC032362
• Gene Symbol: TREM2
• Gene ID (NCBI): 54209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NZC2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TREM2 (triggering receptor expressed on myeloid cells 2) is a cell surface receptor belongs to TREM family that is expressed on osteoclast, dendritic cells, macrophages, nature killers, neutrophils and microglia (PMID: 19302484). TREM2 is localized predominantly in the Golgi complex, but also shuttles to and from the cell surface in endocytic and exocytic vesicles (PMID: 16675145). TREM2 associates with DAP12 to initiate the intracellular signalling cascade via an immunoreceptor tyrosine-based activation motif (ITAM) domain and tyrosine-kinases (PMID: 23977213). TREM2 has a calculated molecular mass of ~25kDa, but apparent molecular mass of ~40kDa (PMID: 24078628). In addition, TREM2 has a soluble form termed as sTREM-2 with molecular weights ranging between about 24kDa and 40kDa (PMID: 18790823). Loss-of-function mutations in either TREM2 or DAP12 can cause Nasu-Hakola disease (PMID: 19302484).