Product Information
83438-2-PBS targets TREM2 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Eg0747 Product name: Recombinant human TREM2 protein Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 19-174 aa of BC032362 Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRPSQGSHLPSCLSK Predict reactive species | 
                                    
| Full Name | triggering receptor expressed on myeloid cells 2 | 
| Calculated Molecular Weight | 222 aa, 25 kDa | 
| GenBank Accession Number | BC032362 | 
| Gene Symbol | TREM2 | 
| Gene ID (NCBI) | 54209 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q9NZC2 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 
