TRMT10B Polyclonal antibody

• 

  WB analysis using 33056-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33056-1-AP (RG9MTD3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

TRMT10B Polyclonal Antibody for WB, ELISA

Cat No. 33056-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.1.1.221, RG9MTD3, RNA (guanine-9-)-methyltransferase domain-containing protein 3, tRNA (guanine(9)-N(1))-methyltransferase TRMT10B, tRNA methyltransferase 10 homolog B

---

Tested Applications

• Positive WB detected in: HAP1 cells, HL-60 cells, HeLa cells, Raji cells, SH-SY5Y cells, SK-N-SH cells, THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33056-1-AP targets TRMT10B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36835

  Product name: Recombinant human RG9MTD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC012175

  Sequence: MDWKLEGSTQKVESPVLQGQEGILEETGEDGLPEGFQLLQIDAEGECQEGEILATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPGICPQHSKRFLRALTKDKLLEAKHSGPRLCIDLSMTHYMSKK

• Full Name: RNA (guanine-9-) methyltransferase domain containing 3
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC012175
• Gene Symbol: RG9MTD3
• Gene ID (NCBI): 158234
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6PF06
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The TRM10 family of methyltransferases is responsible for the N1-methylation of purines at position 9 of tRNAs in Archaea and Eukarya. The human genome encodes three TRM10-type enzymes. TRMT10B is the first m1A9-specific tRNA methyltransferase found in eukaryotes and is responsible for the modification of a single nuclear-encoded tRNA. Furthermore, we show that the lack of G9 methylation causes a decrease in the steady-state levels of the initiator tRNAiMet-CAT and an alteration in its further post-transcriptional modification (PMID: 32392304).