TRMT1L/C1orf25 Polyclonal antibody

• 

  WB analysis using 33811-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33811-1-AP (TRMT1L/C1orf25 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

TRMT1L/C1orf25 Polyclonal Antibody for WB, ELISA

Cat No. 33811-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C1orf25, TRMT1L, tRNA methyltransferase 1-like

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33811-1-AP targets TRMT1L/C1orf25 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36582

  Product name: Recombinant human C1orf25 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 570-733 aa of BC045535

  Sequence: TPQSQFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQKTDVSTEHPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFDPMGVRTDAPLMQFKSILLKYSTPTYTGGQSESHVQSASEDTVTERVEMSVNDKAEASGCRRW

• Full Name: chromosome 1 open reading frame 25
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC045535
• Gene Symbol: C1orf25
• Gene ID (NCBI): 81627
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z2T5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRMT1L (tRNA methyltransferase 1-like), formerly known as C1orf25, is a vertebrate paralog of the evolutionarily conserved TRMT1 (tRNA methyltransferase 1). Knockout of TRMT1L in mice resulted in significant motor coordination impairment and abnormal exploratory behavior, indicating that its activity is also related to neural function (PMID: 17198746). Human TRMT1L catalyzes m2 and 2G in tyrosine tRNAs and simultaneously regulates acp3U in tRNAs (PMID: 39786990).