TRPM2 Polyclonal antibody

• 

  IHC staining of mouse brain using 21842-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21842-1-AP (TRPM2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21842-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21842-1-AP (TRPM2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 21842-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using TRPM2 antibody (21842-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse brain using 21842-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using TRPM2 antibody (21842-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

TRPM2 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 21842-1-AP

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, ELISA

Synonyms

EREG 1, EREG1, Estrogen-responsive element-associated gene 1 protein, KNP 3, KNP3

---

Tested Applications

• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21842-1-AP targets TRPM2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16522

  Product name: Recombinant human TRPM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1217-1553 aa of BC112342

  Sequence: LKRSGSMEQRLASLEEQVAQTARALHWIVRTLRASGFSSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNEKVPWETEFLIYDPPFYTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQAGLPLNPMGRTGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQKAAAEFGAHY

• Full Name: transient receptor potential cation channel, subfamily M, member 2
• Calculated Molecular Weight: 171 kDa
• GenBank Accession Number: BC112342
• Gene Symbol: TRPM2
• Gene ID (NCBI): 7226
• RRID: AB_3085674
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94759
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alice (Verified Customer) (02-02-2026)

This antibody is validated in immunofluorescence (dilution 1/250).

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1/250

FH

Alice (Verified Customer) (04-03-2025)

I tested this antibody in Western blot, and it works very well. There is no non-specific binding.

• Applications: Western Blot