TSC22D1 Polyclonal antibody

TSC22D1 Polyclonal Antibody for ELISA
Cat No. 17055-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Cerebral protein 2, KIAA1994, Regulatory protein TSC 22, RP11 269C23.2, TGFB1I4, TSC22, TSC22 domain family protein 1, TSC22 domain family, member 1, TSC22D1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

17055-1-AP targets TSC22D1 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10763

Product name: Recombinant human TSC22D1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-144 aa of BC016867

Sequence: MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA

Predict reactive species
Full Name TSC22 domain family, member 1
Calculated Molecular Weight 144 aa, 16 kDa
GenBank Accession NumberBC016867
Gene Symbol TSC22D1
Gene ID (NCBI) 8848
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15714
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TSC22 domain family 1, transforming growth factor beta 1 induced transcript 4, (TSC22D1, synonyms: TSC22, TGFB1I4, MGC17597) is a member of a family of leucine zipper containing transcription factors with repressor activity and belongs to the large family of early response genes. TSC-22 regulates cell growth and differentiation, and cell death. Leucine zipper structure of TSC22 inhibits the anchorage independent growth of cancer cells. TSC-22 is also an important downstream component of peroxisome proliferator-activated receptor (PPAR) and TGF-beta signaling during intestinal epithelial cell differentiation. This antibody is a rabbit polyclonal antibody raised against full length TSC22D1 of human origin.

Loading...
||
New chat

Able

正在加载,请稍候...