TSEN15 Polyclonal antibody

• 

  WB analysis using 26054-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26054-1-AP (TSEN15 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TSEN15 Polyclonal Antibody for WB, ELISA

Cat No. 26054-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

tRNA intron endonuclease Sen15, SEN15 homolog, sen15, HsSEN15, C1orf19

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26054-1-AP targets TSEN15 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22082

  Product name: Recombinant human TSEN15 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-171 aa of BC022030

  Sequence: MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR

• Full Name: tRNA splicing endonuclease 15 homolog (S. cerevisiae)
• Calculated Molecular Weight: 171 aa, 19 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC022030
• Gene Symbol: TSEN15
• Gene ID (NCBI): 116461
• RRID: AB_3669520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WW01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TSEN15 is the non-catalytic subunit of the tRNA-splicing endonuclease complex, which is a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini (PMID: 15109492, 27392077).