Product Information
84437-3-PBS targets TSLP in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1238 Product name: Recombinant Human TSLP protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-159 aa of NM_033035.5 Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species |
| Full Name | thymic stromal lymphopoietin |
| Calculated Molecular Weight | 18 kDa |
| GenBank Accession Number | NM_033035.5 |
| Gene Symbol | TSLP |
| Gene ID (NCBI) | 85480 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q969D9-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
