TSR1 Polyclonal antibody

• 

  WB analysis using 29957-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29957-1-AP (TSR1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U-251 using 29957-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using TSR1 antibody (29957-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

TSR1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 29957-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Pre-rRNA-processing protein TSR1 homolog, KIAA1401, FLJ10534

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, L02 cells, U-251 cells
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29957-1-AP targets TSR1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31575

  Product name: Recombinant human TSR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 456-804 aa of NM_018128

  Sequence: DDLYDKKVDEEAEAKMLEKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKEELIFHCGFRRFRASPLFSQHTAADKHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWTYDPYVPEPVPWLKSEISSTVPQGGME

• Full Name: TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)
• Calculated Molecular Weight: 92KD
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: NM_018128
• Gene Symbol: TSR1
• Gene ID (NCBI): 55720
• RRID: AB_3086199
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2NL82
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.