TTC12 Polyclonal antibody, PBS Only

• 

  WB analysis using 28216-1-AP (same clone as 28216-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28216-1-AP (TTC12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28216-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 28216-1-AP (same clone as 28216-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28216-1-AP (TTC12 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28216-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 28216-1-AP (same clone as 28216-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28216-1-AP (TTC12 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28216-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 28216-1-AP (same clone as 28216-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using 28216-1-AP (TTC12 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28216-1-PBS in a different storage buffer formulation.

TTC12 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28216-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

28216-1-PBS targets TTC12 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28199

  Product name: Recombinant human TTC12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-257 aa of BC032355

  Sequence: MDADKEKDLQKFLKNVDEISNLIQEMNSDDPVVQQKAVLETEKRLLLMEEDQEEDECRTTLNKTMISPPQTALKSAEEINSEAFLASVEKDAKERAKRRRENKVLADALKEKGNEAFAEGNYETAILRYSEGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWALKCDEKCTKAYFHMGKANLALKNYSVSRECYKKILEINPKLQTQVKGYLNQVDLQEKADLQEKEAHELLDSGKNTAVTTKNLLETLSKPDQ

• Full Name: tetratricopeptide repeat domain 12
• Calculated Molecular Weight: 79 kDa
• Observed Molecular Weight: 79 kDa
• GenBank Accession Number: BC032355
• Gene Symbol: TTC12
• Gene ID (NCBI): 54970
• RRID: AB_2881092
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H892
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.