TTC21B Polyclonal antibody, PBS Only

• 

  WB analysis using 30112-1-AP (same clone as 30112-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30112-1-AP (TTC21B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30112-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 30112-1-AP (same clone as 30112-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30112-1-AP (TTC21B antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30112-1-PBS in a different storage buffer formulation.

TTC21B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30112-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30112-1-PBS targets TTC21B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32456

  Product name: Recombinant human TTC21B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 149-462 aa of NM_024753

  Sequence: AWLDITRGKEPYTKKALKYFEEGLQDGNDTFALLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSALVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLNDVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQ*

• Full Name: tetratricopeptide repeat domain 21B
• Calculated Molecular Weight: 151KD
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: NM_024753
• Gene Symbol: TTC21B
• Gene ID (NCBI): 79809
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z4L5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TTC21B, also known as THM1, IFT139, belongs to the TTC21 family, containing several tetratricopeptide repeat (TPR) domains. TTC21B is a component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs). TTC21B is essential for retrograde trafficking of IFT-1, IFT-B, and GPCRs (PubMed:27932497). TTC21B is localized to the cilium axoneme and may play a role in retrograde intraflagellar transport in cilia (PMID: 18327258). Mutations in TTC21B are associated with nephronophthisis 12 (NPHP12)and short-rib thoracic dysplasia 4 with or without polydactyly (SRTD4)(PMID: 21258341).