TTF2 Polyclonal antibody, PBS Only

• 

  WB analysis of A2780 using 13722-1-AP (same clone as 13722-1-PBS)

  A2780 cells were subjected to SDS PAGE followed by western blot with 13722-1-AP (TTF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13722-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13722-1-AP (same clone as 13722-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13722-1-AP (TTF2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A2780 using 13722-1-AP (same clone as 13722-1-PBS)

  A2780 cells were subjected to SDS PAGE followed by western blot with 13722-1-AP (TTF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13722-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A2780 using 13722-1-AP (same clone as 13722-1-PBS)

  IP result of anti-TTF2 (IP:13722-1-AP, 4ug; Detection:13722-1-AP 1:500) with A2780 cells lysate 840ug. This data was developed using the same antibody clone with 13722-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 13722-1-AP (same clone as 13722-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 13722-1-AP (TTF2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13722-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 13722-1-AP (same clone as 13722-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 13722-1-AP (TTF2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13722-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13722-1-AP (same clone as 13722-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TTF2 antibody (13722-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (black). This data was developed using the same antibody clone with 13722-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13722-1-AP (same clone as 13722-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TTF2 antibody (13722-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 13722-1-PBS in a different storage buffer formulation.

TTF2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 13722-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

13722-1-PBS targets TTF2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4671

  Product name: Recombinant human TTF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC030058

  Sequence: MEEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQLIKGEGEEKKADKKQREKGDQLFDQKKEQKPEMMEKDLSSGLVPKKKQSVVQEKKQEEGAEIQCEAETGGTHKRDFSEIKSQQCQGNELTRPSASSQEKSSGKSQDVQRESEPLREKVTQLLPQNVHSHNSISKPQKGGPLNKEYTNWEAKETKAKDGPS

• Full Name: transcription termination factor, RNA polymerase II
• Calculated Molecular Weight: 1162 aa, 129 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC030058
• Gene Symbol: TTF2
• Gene ID (NCBI): 8458
• RRID: AB_2262865
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNY4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transcription elongation is an key target for control of eukaryotic gene expression. After initiating from a promoter, the RNA polymerase II elongation complex is subjected to a block to elongation by the action of components of N-TEF (negative transcription elongation factor) [PMID: 9748214]. Transcription termination factor 2 (TTF2) is a DsDNA-dependent ATPase that acts as a transcription termination factor by coupling ATP hydrolysis with removal of RNA polymerase II from the DNA template. It also contribute to mitotic transcription repression, and involved in pre-mRNA splicing[PMID:15125840, 12927788].