TTK Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84744-1-RR (same clone as 84744-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 84744-1-RR (TTK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84744-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 84744-1-RR (same clone as 84744-1-PBS)

  WB result of TTK antibody (84744-1-RR; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TTK transfected HEK-293 cells. This data was developed using the same antibody clone with 84744-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TTK Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84744-1-PBS

Clone No.241873B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

241873B2, EC:2.7.12.1, ESK, hMPS1, Mps 1

---

Product Information

84744-1-PBS targets TTK in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20556

  Product name: Recombinant human TTK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 536-789 aa of BC000633

  Sequence: SSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHP

• Full Name: TTK protein kinase
• Calculated Molecular Weight: 97 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC000633
• Gene Symbol: TTK
• Gene ID (NCBI): 7272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P33981
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mps1 family of kinases colocalizes with mitotic checkpoint proteins in kinetochores and/or spindle pole bodies/centrosomes. TTK has been shown to be a cell cycle-regulated kinase displaying maximum activity during M phase(PMID:15618221). Its kinase activity is required for proper chromosome segregation during mitosis through its involvements in microtubule-chromosome attachment error correction and the mitotic checkpoint(PMID:20937696). TTK mRNA is present at relatively high levels in testis and thymus, tissues which contain a large number of proliferating cells, but is not detected in most other benign tissues (PMID:1639825). It has 2 isoforms produced by alternative splicing (PMID:25137017).