Filter:
  • Western Blot (WB) analysis of various lysates using Beta Tubulin Polyclonal antibody (10068-1-AP)

    WB analysis using 10068-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 10068-1-AP (beta Tubulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using Beta Tubulin Polyclonal antibody (10068-1-AP)

    WB analysis using 10068-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 10068-1-AP (Beta Tubulin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  • Immunoprecipitation (IP) experiment of HEK-293 cells using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IP experiment of HEK-293 using 10068-1-AP

    IP result of anti-Beta Tubulin (IP:10068-1-AP, 4ug; Detection:10068-1-AP 1:5000) with HEK-293 cells lysate 2320 ug.

  • Immunohistochemistry (IHC) staining of mouse brain tissue using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IHC staining of mouse brain using 10068-1-AP

    Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10068-1-AP (beta Tubulin antibody at dilution of 1:50 (under 40x lens).

  • Immunohistochemistry (IHC) staining of rat brain tissue using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IHC staining of rat brain using 10068-1-AP

    Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 10068-1-AP (Beta Tubulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of rat brain tissue using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IHC staining of rat brain using 10068-1-AP

    Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 10068-1-AP (beta Tubulin antibody) at dilution of 1:200 (under 10x lens).

  • Immunohistochemistry (IHC) staining of rat brain tissue using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IHC staining of rat brain using 10068-1-AP

    Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 10068-1-AP (beta Tubulin antibody) at dilution of 1:200 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human brain tissue using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IHC staining of human brain using 10068-1-AP

    Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10068-1-AP (beta Tubulin antibody at dilution of 1:50 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human brain tissue using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IHC staining of human brain using 10068-1-AP

    Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10068-1-AP (beta Tubulin antibody at dilution of 1:50 (under 40x lens).

  • Immunofluorescence (IF) / fluorescent staining of C2C12 cells using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IF Staining of C2C12 using 10068-1-AP

    Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using Beta Tubulin antibody (10068-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IF Staining of HepG2 using 10068-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 10068-1-AP (beta Tubulin antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using Beta Tubulin Polyclonal antibody (10068-1-AP)

    IF Staining of HepG2 using 10068-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 10068-1-AP (beta Tubulin antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  • Flow cytometry (FC) experiment of HeLa cells using Beta Tubulin Polyclonal antibody (10068-1-AP)

    FC experiment of HeLa using 10068-1-AP

    1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human Beta Tubulin (10068-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

"Beta Tubulin Antibodies" Comparison

View side-by-side comparison of Beta Tubulin antibodies from other vendors to find the one that best suits your research needs.

Beta Tubulin Polyclonal antibody

Beta Tubulin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10068-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Tubulin beta 3 chain, Tubulin beta III, TUBB4, Tubulin beta-3 chain, Tubulin beta-4 chain

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse cerebellum tissue, HeLa cells, mouse brain tissue, rat brain tissue, HEK-293 cells, Jurkat cells, HepG2 cells, A431 cells, NIH/3T3 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inrat brain tissue, human brain tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inC2C12 cells, HepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10068-1-AP targets Beta Tubulin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine, zebrafish, bovine, silkworm, caenorhabditis elegans
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0117

Product name: Recombinant human Tubulin-beta protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 44-259 aa of BC000748

Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP

Predict reactive species
Full Name tubulin, beta 3
Calculated Molecular Weight 450 aa, 50 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC000748
Gene Symbol TUBB3
Gene ID (NCBI) 10381
RRIDAB_2303998
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13509
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.

Protocols

Product Specific Protocols
WB protocol for Beta Tubulin antibody 10068-1-APDownload protocol
IHC protocol for Beta Tubulin antibody 10068-1-APDownload protocol
IF protocol for Beta Tubulin antibody 10068-1-APDownload protocol
IP protocol for Beta Tubulin antibody 10068-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

Complement Signals Determine Opposite Effects of B Cells in Chemotherapy-Induced Immunity.

Authors - Yiwen Lu
humanWB

Adv Mater

Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment

Authors - Yuewen Zhai
humanWB

Nat Struct Mol Biol

CRISPR-Cas9-based functional interrogation of unconventional translatome reveals human cancer dependency on cryptic non-canonical open reading frames

Authors - Caishang Zheng
WB

Nat Commun

Gonococcal OMV-delivered PorB induces epithelial cell mitophagy

Authors - Shuai Gao
humanWB

Nat Commun

MYG1 drives glycolysis and colorectal cancer development through nuclear-mitochondrial collaboration

Authors - Jianxiong Chen
WB

Adv Sci (Weinh)

EGFR-Induced and c-Src-Mediated CD47 Phosphorylation Inhibits TRIM21-Dependent Polyubiquitylation and Degradation of CD47 to Promote Tumor Immune Evasion

Authors - Linyong Du
Loading...
||
New chat Able
正在加载,请稍候...