"Beta Tubulin Antibodies" Comparison
View side-by-side comparison of Beta Tubulin antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | U-251 cells, mouse kidney tissue, HEK-293 cells, rat kidney tissue, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human colon tissue, human cerebellum tissue, mouse brain tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10094-1-AP targets Beta Tubulin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, chicken, zebrafish, sheep, goat, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0136 Product name: Recombinant human tubulin-beta protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 57-294 aa of BC000748 Sequence: HKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMF Predict reactive species |
| Full Name | tubulin, beta 3 |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC000748 |
| Gene Symbol | TUBB3 |
| Gene ID (NCBI) | 10381 |
| RRID | AB_2210695 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13509 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Beta Tubulin antibody 10094-1-AP | Download protocol |
| IF protocol for Beta Tubulin antibody 10094-1-AP | Download protocol |
| IHC protocol for Beta Tubulin antibody 10094-1-AP | Download protocol |
| IP protocol for Beta Tubulin antibody 10094-1-AP | Download protocol |
| WB protocol for Beta Tubulin antibody 10094-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Nat Biotechnol Magnify is a universal molecular anchoring strategy for expansion microscopy | ||
Nat Nanotechnol Long-term pulmonary exposure to multi-walled carbon nanotubes promotes breast cancer metastatic cascades. | ||
Cell Res Sensing of DNA double-strand breaks by the NHEJ system stabilizes RORγt transcriptional activity and shapes Th17 pathogenicity in autoimmunity | ||
Cell Metab TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis. | ||
Cell Metab Ejection of damaged mitochondria and their removal by macrophages ensure efficient thermogenesis in brown adipose tissue. | ||
Nat Cell Biol Single-cell multi-omics profiling of human preimplantation embryos identifies cytoskeletal defects during embryonic arrest |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
P (Verified Customer) (01-29-2026) | excellent!
![]() |
SK (Verified Customer) (01-29-2026) | excellent
![]() |
SONAL (Verified Customer) (11-14-2025) | good
|
SONAL (Verified Customer) (11-14-2025) | good
|
Dan (Verified Customer) (08-25-2025) | transfection done on 293T and C2C12 cells and 40ug loaded for western blot. two major bands seen at 56 and 72KD
![]() |
PK (Verified Customer) (08-14-2024) | excellent
![]() |
Susanne (Verified Customer) (11-25-2022) |
![]() |
Macarena (Verified Customer) (10-07-2022) | excellent results. No non specific binding. The loading control of choice in my lab
|
parisa (Verified Customer) (12-03-2021) | We had the anti-mouse antibody and tried this anti-rabbit antibody which worked very well and will be helpful for us.
|
Azita (Verified Customer) (06-02-2021) | Immunohistochemistry labelling of (4% PFA) fixed mice spinal cord tissues using Beta Tubulin Polyclonal Antibody at dilution of 1:50 showed strong labelling.
|
Elise (Verified Customer) (12-27-2020) | Works perfectly well!
|








































