Tetranectin Recombinant monoclonal antibody

• 

  WB analysis using 85689-5-RR

  Human plasma were subjected to SDS PAGE followed by western blot with 85689-5-RR (Tetranectin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 85689-5-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85689-5-RR (Tetranectin antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 85689-5-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85689-5-RR (Tetranectin antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Tetranectin Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85689-5-RR

Clone No.243017E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CLEC3B, C-type lectin domain family 3 member B, Plasminogen kringle 4-binding protein, TN, TNA

---

Tested Applications

• Positive WB detected in: human plasma
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85689-5-RR targets Tetranectin in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3063

  Product name: Recombinant Human CLEC3B protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-202 aa of NM_003278.2

  Sequence: EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

• Full Name: C-type lectin domain family 3, member B
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NM_003278.2
• Gene Symbol: CLEC3B
• Gene ID (NCBI): 7123
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05452
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C-Type Lectin Domain Family 3 Member B (CLEC3B) is a transmembrane Ca2+-binding protein, locating in cell plasma, extracellular matrix and exosomes. Downregulation of CLEC3B has been reported in various diseases. It was demonstrated in CLEC3B-deficient mice that the absence of CLEC3B impeded the mineralization process in osteogenesis. (PMID: 31477130)