UBE2E2 Polyclonal antibody, PBS Only

• 

  WB analysis of human thyroid gland using 11844-1-AP (same clone as 11844-1-PBS)

  human thyroid gland tissue were subjected to SDS PAGE followed by western blot with 11844-1-AP (UBE2E2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11844-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11844-1-AP (same clone as 11844-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11844-1-AP (UBE2E2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11844-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse embryo using 11844-1-AP (same clone as 11844-1-PBS)

  mouse embryo tissue were subjected to SDS PAGE followed by western blot with 11844-1-AP (UBE2E2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11844-1-AP (same clone as 11844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11844-1-AP (UBE2E2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11844-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11844-1-AP (same clone as 11844-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using UBE2E2 antibody 11844-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 11844-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

UBE2E2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11844-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11844-1-PBS targets UBE2E2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2509

  Product name: Recombinant human UBE2E2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC022332

  Sequence: MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

• Full Name: ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast)
• Calculated Molecular Weight: 201 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC022332
• Gene Symbol: UBE2E2
• Gene ID (NCBI): 7325
• RRID: AB_2210274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LR5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UBE2E2(ubiquitin-conjugating enzyme E2 E2) is also named as UBCH8 and belongs to the ubiquitin-conjugating enzyme family. This gene encodes a 22 kDa protein that functions as a major ISG15 E2 enzyme raises the possibility that ISG15 conjugation might use UbcH8-competent Ub E3 enzymes and also function as an E2 for several Ub E3 enzymes, including both HECT E3s and RING E3s(PMID: 15131269).