UBL3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87070-3-RR (same clone as 87070-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87070-3-RR (UBL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87070-3-PBS in a different storage buffer formulation.

UBL3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87070-3-PBS

Clone No.252163G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Membrane-anchored ubiquitin-fold protein, PNSC1, Protein HCG-1, Ubiquitin-like protein 3

---

Product Information

87070-3-PBS targets UBL3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5932

  Product name: Recombinant human UBL3 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-117 aa of NM_007106.3

  Sequence: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL

• Full Name: ubiquitin-like 3
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: NM_007106.3
• Gene Symbol: UBL3
• Gene ID (NCBI): 5412
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95164
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ubiquitin-like 3 (UBL3)/membrane-anchored Ub-fold protein (MUB) acts as a post-translational modification (PTM) factor to regulate efficient protein sorting to sEVs (small extracellular vesicles). (PMID: 31363817, PMID: 30258067).