UBXN7 Polyclonal antibody

• 

  WB analysis using 32722-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32722-1-AP (UBXN7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

UBXN7 Polyclonal Antibody for WB, ELISA

Cat No. 32722-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KIAA0794, UBX domain-containing protein 7, UBXD7

---

Tested Applications

• Positive WB detected in: COLO 320 cells, RT-4 cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32722-1-AP targets UBXN7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38516

  Product name: Recombinant human UBXN7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-200 aa of NM_015562.1

  Sequence: LDGGGIAEEPSTSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREH

• Full Name: UBX domain protein 7
• Calculated Molecular Weight: 55kDa，489aa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: NM_015562.1
• Gene Symbol: UBXN7
• Gene ID (NCBI): 26043
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O94888
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBXN7(UBX domain protein 7) is a protein with ubiquitin-binding activity and ubiquitin-proteasome-binding activity. It contains four different domains, namely, the N-terminal UBA domain, the UAS domain, the Ubiquitin Interaction motif (UIM) and the C-terminal UBX domain. The level of UBXN7 will affect the metabolic state of cells. High levels of UBXN7 and HIF-1α accumulation support glycolysis, while inactivation of UBXN7 and activation of NRF2 increase oxidative phosphorylation (PMID: 33444648).