UCRC Polyclonal antibody

• 

  WB analysis of human heart using 17779-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 17779-1-AP (UCRC antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 17779-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17779-1-AP (UCRC antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 17779-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 17779-1-AP (UCRC antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

UCRC Polyclonal Antibody for WB, ELISA

Cat No. 17779-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Complex III subunit 9, Complex III subunit X, HSPC051, HSPC119, HSPC151, UCRC, UQCR10

---

Tested Applications

• Positive WB detected in: human heart tissue, human liver tissue, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

17779-1-AP targets UCRC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10911

  Product name: Recombinant human UCRC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-63 aa of BC005402

  Sequence: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

• Full Name: ubiquinol-cytochrome c reductase complex (7.2 kD)
• Calculated Molecular Weight: 63 aa, 7 kDa
• Observed Molecular Weight: 7 kDa
• GenBank Accession Number: BC005402
• Gene Symbol: UCRC
• Gene ID (NCBI): 29796
• RRID: AB_2035028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UDW1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Sci Rep; Transgenic hepatitis B: a new model of HBV infection.; Authors - Hubert D-J Daniel
human	WB,IF	Biochem Genet; Identification of a Novel Mitochondrial-Related Gene Signature for BMSCs in Osteoporosis Combining Single-Cell and Bulk Transcriptome Data; Authors - Jishi Jiang