Tested Applications
Positive WB detected in | human heart tissue, human liver tissue, mouse skeletal muscle tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:300-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
17779-1-AP targets UCRC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10911 Product name: Recombinant human UCRC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC005402 Sequence: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK Predict reactive species |
Full Name | ubiquinol-cytochrome c reductase complex (7.2 kD) |
Calculated Molecular Weight | 63 aa, 7 kDa |
Observed Molecular Weight | 7 kDa |
GenBank Accession Number | BC005402 |
Gene Symbol | UCRC |
Gene ID (NCBI) | 29796 |
RRID | AB_2035028 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9UDW1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for UCRC antibody 17779-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biochem Genet Identification of a Novel Mitochondrial-Related Gene Signature for BMSCs in Osteoporosis Combining Single-Cell and Bulk Transcriptome Data |