UGP2 Polyclonal antibody

• 

  WB analysis using 10391-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10391-1-AP (UGP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10391-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10391-1-AP (UGP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10391-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10391-1-AP (UGP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 10391-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 10391-1-AP (UGP2 antibody) at dilution of 1:100 (under 25x lens).

• 

  IHC staining of human liver cancer using 10391-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10391-1-AP (UGP2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 10391-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10391-1-AP (UGP2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

UGP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10391-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:2.7.7.9, UDPG, UDP-glucose pyrophosphorylase, UDPGP2, UGPase

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human ovary tumor tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:5000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 3 publications below
• IHC: See 2 publications below

Product Information

10391-1-AP targets UGP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0590

  Product name: Recombinant human UGP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-287 aa of BC002954

  Sequence: SQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQY

• Full Name: UDP-glucose pyrophosphorylase 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC002954
• Gene Symbol: UGP2
• Gene ID (NCBI): 7360
• RRID: AB_2272775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16851
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UDP-glucose pyrophosphorylase 2 (UGP2, synonyms: UDPG, UGPP2, UDPGP2, Phc379)is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. So far two isoforms are encoded by two transcript variants have been found.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	iScience; MYCT1 alters the glycogen shunt by regulating selective translation of RACK1-mediated enzymes.; Authors - Dong-Xue Ding
rat	IHC	Toxicol Sci; Mitochondrial prohibitins and septin 9 are implicated in the onset of rat hepatocarcinogenesis.; Authors - Kakehashi Anna A
human	IHC	Dis Markers; Low UGP2 Expression Is Associated with Tumour Progression and Predicts Poor Prognosis in Hepatocellular Carcinoma.; Authors - Qiuyue Hu
human	WB	J Cell Biochem; Identification of UGP2 as a progression marker that promotes cell growth and motility in human glioma.; Authors - Chun Zeng ; KD Validated
human	WB	bioRxiv; Glucose-dependent glycosphingolipid biosynthesis fuels CD8 + T cell function and tumor control; Authors - Joseph Longo ; KD Validated