UNC5D Polyclonal antibody

UNC5D Polyclonal Antibody for WB, ELISA
Cat No. 29941-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

FLJ16019, KIAA1777, Netrin receptor UNC5D, PRO34692, Protein unc 5 homolog 4, Protein unc 5 homolog D, unc 5 homolog D (C. elegans), UNC5D, Unc5h4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse kidney tissue, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29941-1-AP targets UNC5D in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31973

Product name: Recombinant human UNC5D protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 33-152 aa of NM_080872

Sequence: ARGTDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASV

Predict reactive species
Full Name unc-5 homolog D (C. elegans)
Calculated Molecular Weight106KD
Observed Molecular Weight120 kDa, 68 kDa
GenBank Accession NumberNM_080872
Gene Symbol UNC5D
Gene ID (NCBI) 137970
RRIDAB_3086195
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6UXZ4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UNC5D, also named as KIAA1777 and UNC5H4, belongs to the unc-5 family. It is a receptor for netrin. It may be involved in axon guidance by mediating axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. Previous studies have demonstrated that UNC5D can be cleavaged by caspase 2 and 3, suggesting that UNC5D serves as a direct substrate for caspases 2 and 3 (PMID: 23778138).

Protocols

Product Specific Protocols
WB protocol for UNC5D antibody 29941-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...