p115, USO1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• p115, USO1 Polyclonal antibody (13509-1-AP)

• Featured Product
• KD/KO Validated

p115, USO1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13509-1-AP Copied!

Publications (29)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

USO1, General vesicular transport factor p115, Protein USO1 homolog, TAP, Transcytosis-associated protein

• 

  WB analysis of HeLa using 13509-1-AP

  WB result of p115, USO1 antibody (13509-1-AP; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-p115, USO1 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13509-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13509-1-AP (p115, USO1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13509-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13509-1-AP (p115, USO1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 13509-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 13509-1-AP (p115, USO1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 13509-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13509-1-AP (p115, USO1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 13509-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13509-1-AP (p115, USO1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 13509-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13509-1-AP (p115, USO1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 13509-1-AP

  IP result of anti-p115, USO1 (IP:13509-1-AP, 3ug; Detection:13509-1-AP 1:1500) with mouse brain tissue lysate 7000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 13509-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13509-1-AP (p115, USO1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 13509-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 13509-1-AP (p115, USO1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13509-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13509-1-AP (p115, USO1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 13509-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 13509-1-AP (p115, USO1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13509-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using p115, USO1 antibody (13509-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13509-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 13509-1-AP (p115, USO1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13509-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 13509-1-AP (p115, USO1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13509-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using p115, USO1 antibody (13509-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for p115, USO1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, human brain tissue, mouse brain tissue, mouse testis tissue, mouse thymus tissue, SH-SY5Y cells, HepG2 cells, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human lung cancer tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13509-1-AP targets p115, USO1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4431

  Product name: Recombinant human p115, USO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 660-961 aa of BC032654

  Sequence: EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI

• Full Name: USO1 homolog, vesicle docking protein (yeast)
• Calculated Molecular Weight: 962 aa, 108 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC032654
• Gene Symbol: USO1
• Gene ID (NCBI): 8615
• RRID: AB_2257094
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60763
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

p115, also known as USO1, TAP (transcytosis-associated protein) or VDP (vesicle docking protein) is a general vesicular transport factor and plays an important role at different steps of vesicular transport. It is a 962-residue peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase (PMID: 9478999). p115 forms stable homodimers (PMID: 19247479). Rab1 recruits p115 to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where p115 interacts directly with a select set of SNARE proteins (PMID: 10903204). p115 is required for intra-Golgi transport, and also functions in endoplasmic reticulum to Golgi trafficking, Golgi biogenesis and exocytotic transport (PMID: 19247479).

Publications

What published studies show

The USO1 (p115) Polyclonal antibody (Cat# 13509-1-AP) has 29 citations. These appear in journals including Science, Nature Communications, Molecular Cell, EMBO Journal, Cell Death & Disease, Journal of Cell Biology, Journal of Virology, Journal of Immunology, Journal of Cell Science, FASEB Journal, PLoS Pathogens, PLoS ONE, eLife, iScience, and others. Research fields span Golgi apparatus structure and trafficking, secretory pathway, cell polarity, autophagy, viral infection (CMV, HSV, enterovirus), immune regulation, stem cell function, and Golgi-related disease mechanisms.

Automatically generated from the 29 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Science; Atlas of lysosomal aging reveals a metabolite signature shared with lysosomal storage disorders.; Authors - Anna M. Puszynska
		Nat Commun; Golgi organization regulates stem cell function in the small intestine.; Authors - Ilya Belevich
human	IF	Nat Commun; AmotL2 disrupts apical-basal cell polarity and promotes tumour invasion.; Authors - Mahdi Mojallal
human	WB,IF	Mol Cell; An mTORC1-GRASP55 signaling axis controls unconventional secretion to reshape the extracellular proteome upon stress.; Authors - Julian Nüchel
mouse	IF	Cell Death Dis; Globozoospermia and lack of acrosome formation in GM130-deficient mice.; Authors - Feng Han
human	IF	EMBO J; A coordinated transcriptional program controls de novo Golgi biogenesis.; Authors - Francesca Forno