• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated p115, USO1 Polyclonal antibody

p115, USO1 Polyclonal Antibody for IF/ICC
Cat No. CL488-13509

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

P115, p115, USO1, Protein USO1 homolog, TAP, USO1, VDP, Vesicle docking protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13509 targets p115, USO1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4431

Product name: Recombinant human p115, USO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 660-961 aa of BC032654

Sequence: EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI

Predict reactive species
Full Name USO1 homolog, vesicle docking protein (yeast)
Calculated Molecular Weight 962 aa, 108 kDa
GenBank Accession NumberBC032654
Gene Symbol USO1
Gene ID (NCBI) 8615
RRIDAB_2919074
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60763
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

p115, also known as USO1, TAP (transcytosis-associated protein) or VDP (vesicle docking protein) is a general vesicular transport factor and plays an important role at different steps of vesicular transport. It is a 962-residue peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase (PMID: 9478999). p115 forms stable homodimers (PMID: 19247479). Rab1 recruits p115 to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where p115 interacts directly with a select set of SNARE proteins (PMID: 10903204). p115 is required for intra-Golgi transport, and also functions in endoplasmic reticulum to Golgi trafficking, Golgi biogenesis and exocytotic transport (PMID: 19247479).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 p115, USO1 antibody CL488-13509Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...