CoraLite®594-conjugated p115, USO1 Polyclonal antibody

• 

  IF Staining of HeLa using CL594-13509

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®594 p115, USO1 antibody (CL594-13509) at dilution of 1:200, 488-phalloidin (green).

• Featured Product
• KD/KO Validated

p115, USO1 Polyclonal Antibody for IF/ICC

Cat No. CL594-13509

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

P115, p115, USO1, Protein USO1 homolog, TAP, USO1, VDP, Vesicle docking protein

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-13509 targets p115, USO1 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4431

  Product name: Recombinant human p115, USO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 660-961 aa of BC032654

  Sequence: EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI

• Full Name: USO1 homolog, vesicle docking protein (yeast)
• Calculated Molecular Weight: 962 aa, 108 kDa
• GenBank Accession Number: BC032654
• Gene Symbol: USO1
• Gene ID (NCBI): 8615
• RRID: AB_2919797
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60763
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

p115, also known as USO1, TAP (transcytosis-associated protein) or VDP (vesicle docking protein) is a general vesicular transport factor and plays an important role at different steps of vesicular transport. It is a 962-residue peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase (PMID: 9478999). p115 forms stable homodimers (PMID: 19247479). Rab1 recruits p115 to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where p115 interacts directly with a select set of SNARE proteins (PMID: 10903204). p115 is required for intra-Golgi transport, and also functions in endoplasmic reticulum to Golgi trafficking, Golgi biogenesis and exocytotic transport (PMID: 19247479).