USP50 Polyclonal antibody

USP50 Polyclonal Antibody for WB, ELISA
Cat No. 30239-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Ubiquitin-specific peptidase 50, Ubiquitin carboxyl-terminal hydrolase 50, EC:3.4.19.12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30239-1-AP targets USP50 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31275

Product name: Recombinant human USP50 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 145-290 aa of BC146493

Sequence: NELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHY

Predict reactive species
Full Name ubiquitin specific peptidase 50
Calculated Molecular Weight 339 aa, 39 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberBC146493
Gene Symbol USP50
Gene ID (NCBI) 373509
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ70EL3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP50 (Ubiquitin Specific Peptidase 50) is a deubiquitinating enzyme that belongs to the USP family. It plays a key role in DNA replication, genome stability and cell cycle regulation. Recent studies have found that USP50 maintains the stability of the DNA replication process and telomere integrity by regulating the use of nuclease and deconjugating enzymes. During replication, USP50 was able to inhibit the harmful DNA2 nuclease activity and substitute the use of RecQ deconjugase, thereby preventing replication fork stalling and DNA damage. In addition, USP50 plays a role in the cell cycle G2/M phase transition, assembly of the NLRP3 inflammasome complex, and organization of nuclear speckles. Its loss of function leads to DNA double-strand breaks and telomere instability in cells under replication stress. These findings provide new insights into the understanding of the pathogenesis of genetic diseases and may offer potential targets for the treatment of diseases such as cancer and premature aging.

Protocols

Product Specific Protocols
WB protocol for USP50 antibody 30239-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...