Product Information
67273-3-PBS targets VANGL2 as part of a matched antibody pair:
MP51674-1: 67273-2-PBS capture and 67273-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16980 Product name: Recombinant human VANGL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 268-322 aa of BC103920 Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ Predict reactive species |
| Full Name | vang-like 2 (van gogh, Drosophila) |
| Calculated Molecular Weight | 521 aa, 60 kDa |
| GenBank Accession Number | BC103920 |
| Gene Symbol | VANGL2 |
| Gene ID (NCBI) | 57216 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | Q9ULK5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



