VAPA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VAPA Polyclonal antibody (15275-1-AP)

• Featured Product
• KD/KO Validated

VAPA Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15275-1-AP

Publications(42)

Reviews (4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, COIP, ELISA

Synonyms

33 kDa VAMP associated protein, 33 kDa VAMP-associated protein, hVAP 33, VAMP A, VAMP associated protein A

• 

  WB analysis of HEK-293 using 15275-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15275-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 15275-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 15275-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 15275-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 15275-1-AP

  IP result of anti-VAPA (IP:15275-1-AP, 3ug; Detection:15275-1-AP 1:1000) with HEK-293 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15275-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using VAPA antibody (15275-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse skeletal muscle tissue, human kidney tissue, human brain tissue, HepG2 cells, mouse liver tissue, rat liver tissue, HeLa cells, K-562 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human colon cancer tissue, human liver cancer tissue, mouse brain tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15275-1-AP targets VAPA in WB, IHC, IF/ICC, IP, COIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7393

  Product name: Recombinant human VAPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-221 aa of BC002992

  Sequence: MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFR

• Full Name: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC002992
• Gene Symbol: VAPA
• Gene ID (NCBI): 9218
• RRID: AB_2256991
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0L0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAPA (Vesicle-associated membrane protein-associated protein A), also known as VAP33, is a ubiquitously expressed integral membrane protein of the VAMP-associated protein (VAP) family. It is present in the plasma membrane and in intracellular vesicles, playing a role in vesicle trafficking.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB,CoIP	Cell; Calcium transients on the ER surface trigger liquid-liquid phase separation of FIP200 to specify autophagosome initiation sites; Authors - Qiaoxia Zheng ; KD Validated
human	WB,IP	Nat Microbiol; Toxoplasma effector TgROP1 establishes membrane contact sites with the endoplasmic reticulum during infection.; Authors - Chahat Mehra
human	WB	Autophagy; USP20 deubiquitinates and stabilizes the reticulophagy receptor RETREG1/FAM134B to drive reticulophagy; Authors - Man Zhang
mouse,human	WB	Nat Commun; Variants in the WDR44 WD40-repeat domain cause a spectrum of ciliopathy by impairing ciliogenesis initiation; Authors - Andrea Accogli
rat	IF	Nat Commun; VAP spatially stabilizes dendritic mitochondria to locally support synaptic plasticity; Authors - Ojasee Bapat
mouse	WB,IHC	Nat Commun; Bipolar and schizophrenia risk gene AKAP11 encodes an autophagy receptor coupling the regulation of PKA kinase network homeostasis to synaptic transmission.; Authors - You-Kyung Lee

Reviews

4.5 out of 5

4 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Ziwei (Verified Customer) (01-04-2026)

works as it should be.

• Applications: Western Blot

Ziwei (Verified Customer) (12-14-2025)

The antibody demonstrates reliable performance across multiple experiments.

• Applications: Western Blot

Janathan (Verified Customer) (12-21-2023)

Really good and strong signal in WB and IF. IP works on WB, but not sensitive enough for visualizing with coomassie

• Applications: Western Blot, Immunofluorescence, Immunoprecipitation
• Primary Antibody Dilution: WB: 1:1000 IF: 1:100 IP: 1ug per 1000 ug protein
• Cell Tissue Type: Human skin fibroblasts

Wei (Verified Customer) (09-22-2020)

The antibody have high specific band in western blot, but not so good for heart sections.

• Applications: Western Blot, Immunofluorescence
• Cell Tissue Type: Mouse Heart