VAPA Polyclonal antibody

• 

  WB analysis using 15275-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15275-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 15275-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 15275-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 15275-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15275-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15275-1-AP (VAPA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 15275-1-AP

  IP result of anti-VAPA (IP:15275-1-AP, 3ug; Detection:15275-1-AP 1:1000) with HEK-293 cells lysate 3200ug.

• 

  IHC staining of human colon cancer using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 15275-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15275-1-AP (VAPA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 15275-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using VAPA antibody (15275-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HepG2 using 15275-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using VAPA antibody (15275-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• 

  IF Staining of HEK-293 using 15275-1-AP

  Immunofluorescent analysis of HEK-293 cells using 15275-1-AP (VAPA antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

VAPA Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15275-1-AP

Publications(31)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, COIP, ELISA

Synonyms

33 kDa VAMP associated protein, 33 kDa VAMP-associated protein, hVAP 33, VAMP A, VAMP associated protein A

---

Tested Applications

• Positive WB detected in: HepG2 cells, HEK-293 cells, mouse skeletal muscle tissue, human kidney tissue, human brain tissue, mouse kidney tissue, mouse liver tissue, rat liver tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human colon cancer tissue, human liver cancer tissue, mouse brain tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 22 publications below
• IHC: See 1 publications below
• IF: See 12 publications below
• CoIP: See 3 publications below

Product Information

15275-1-AP targets VAPA in WB, IHC, IF/ICC, IP, COIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7393

  Product name: Recombinant human VAPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-221 aa of BC002992

  Sequence: MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFR

• Full Name: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC002992
• Gene Symbol: VAPA
• Gene ID (NCBI): 9218
• RRID: AB_2256991
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0L0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAPA (Vesicle-associated membrane protein-associated protein A), also known as VAP33, is a ubiquitously expressed integral membrane protein of the VAMP-associated protein (VAP) family. It is present in the plasma membrane and in intracellular vesicles, playing a role in vesicle trafficking.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	COIP	Mol Cell; The ER-Localized Transmembrane Protein EPG-3/VMP1 Regulates SERCA Activity to Control ER-Isolation Membrane Contacts for Autophagosome Formation.; Authors - Yan G Zhao
monkey	WB	Mol Cell; MIGA2 Links Mitochondria, the ER, and Lipid Droplets and Promotes De Novo Lipogenesis in Adipocytes.; Authors - Christophe A C Freyre
mouse	WB	J Clin Invest; Upregulation of Rubicon promotes autosis during myocardial ischemia/reperfusion injury.; Authors - Jihoon Nah
		EMBO J; A selective ER-phagy exerts procollagen quality control via a Calnexin-FAM134B complex.; Authors - Alison Forrester
human	WB	EMBO J; CALCOCO1 acts with VAMP-associated proteins to mediate ER-phagy.; Authors - Thaddaeus Mutugi Nthiga
monkey	WB,IF,CoIP	Curr Biol; The ER Contact Proteins VAPA/B Interact with Multiple Autophagy Proteins to Modulate Autophagosome Biogenesis.; Authors - Yan G Zhao ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Janathan (Verified Customer) (12-21-2023)

Really good and strong signal in WB and IF. IP works on WB, but not sensitive enough for visualizing with coomassie

• Applications: Western Blot, Immunofluorescence, Immunoprecipitation
• Primary Antibody Dilution: WB: 1:1000 IF: 1:100 IP: 1ug per 1000 ug protein
• Cell Tissue Type: Human skin fibroblasts

FH

Wei (Verified Customer) (09-22-2020)

The antibody have high specific band in western blot, but not so good for heart sections.

• Applications: Western Blot, Immunofluorescence
• Cell Tissue Type: Mouse Heart