Vitamin D binding protein Polyclonal antibody

• 

  WB analysis of human plasma using 16922-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human blood using 16922-1-AP

  human blood tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat eye using 16922-1-AP

  rat eye tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (Vitamin D binding protein antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 16922-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse eye using 16922-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 16922-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse eye using 16922-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 16922-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16922-1-AP (Vitamin D binding protein antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16922-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16922-1-AP (Vitamin D binding protein antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human normal colon using 16922-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 16922-1-AP (Vitamin D binding protein antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Vitamin D binding protein Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16922-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

GC, VDBP,GC, Gc protein-derived macrophage activating factor, Gc globulin, DBP-maf

---

Tested Applications

• Positive WB detected in: human blood tissue, human blood, rat eye tissue, mouse eye tissue, PC-3 cells, human plasma, mouse testis tissue
• Positive IHC detected in: human liver tissue, human normal colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

16922-1-AP targets Vitamin D binding protein in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10286

  Product name: Recombinant human VDBP,GC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-474 aa of BC057228

  Sequence: KLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL

• Full Name: group-specific component (vitamin D binding protein)
• Calculated Molecular Weight: 474 aa, 53 kDa
• Observed Molecular Weight: 52-58 kDa
• GenBank Accession Number: BC057228
• Gene Symbol: Vitamin D binding protein
• Gene ID (NCBI): 2638
• RRID: AB_10597098
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02774
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vitamin D binding protein is a sparsely glycosylated serum protein responsible for highly specific binding and tissue-specific delivery of vitamin D and its metabolites. In addition, it is also an actin scavenger, and is the precursor to the immunomodulatory protein, Gc-MAF. Vitamin D binding protein has been proposed to have significant roles in C5a chemotaxis, osteoclast development and possibly in macrophage activation/recruitment.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Ther Methods Clin Dev; Lentiviral vector mediated gene therapy for type I Dent disease ameliorates Dent disease-like phenotypes for three months in ClC-5 null mice; Authors - Manish Kumar Yadav
rat	WB	Sci Rep; PMID: 31792309; Authors - Nela Pavlíková
		Proteomics; Screening for potential serum biomarkers in rat mesangial proliferative nephritis.; Authors - Yang Lu
rat	WB,IHC	Mol Med Rep; Proteomics of acute heart failure in a rat post-myocardial infarction model.; Authors - Yichen Guo
mouse	WB	Pharmaceutics; Evaluation of In Vitro and In Vivo Antiviral Activities of Vitamin D for SARS-CoV-2 and Variants; Authors - Chee-Keng Mok
mouse	IHC	Int Immunopharmacol; Vitamin D attenuates DNCB-induced atopic dermatitis-like skin lesions by inhibiting immune response and restoring skin barrier function; Authors - Renwei Lu