Vitamin D binding protein Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Vitamin D binding protein Polyclonal antibody (16922-1-AP)

Vitamin D binding protein Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16922-1-AP Copied!

Publications (15)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

GC, VDBP,GC, DBP, DBP/GC, DBP-maf

• 

  WB analysis of human plasma using 16922-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human blood using 16922-1-AP

  human blood tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat eye using 16922-1-AP

  rat eye tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (Vitamin D binding protein antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 16922-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 16922-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse eye using 16922-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse eye using 16922-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 16922-1-AP (vitamin D binding protein antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16922-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16922-1-AP (Vitamin D binding protein antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16922-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16922-1-AP (Vitamin D binding protein antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 16922-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 16922-1-AP (Vitamin D binding protein antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Vitamin D binding protein in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human blood tissue, human blood, rat eye tissue, mouse eye tissue, PC-3 cells, human plasma, mouse testis tissue
• Positive IHC detected in: human liver tissue, human normal colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16922-1-AP targets Vitamin D binding protein in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10286

  Product name: Recombinant human VDBP,GC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-474 aa of BC057228

  Sequence: KLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL

• Full Name: group-specific component (vitamin D binding protein)
• Calculated Molecular Weight: 474 aa, 53 kDa
• Observed Molecular Weight: 52-58 kDa
• GenBank Accession Number: BC057228
• Gene Symbol: Vitamin D binding protein
• Gene ID (NCBI): 2638
• RRID: AB_10597098
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02774
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vitamin D binding protein is a sparsely glycosylated serum protein responsible for highly specific binding and tissue-specific delivery of vitamin D and its metabolites. In addition, it is also an actin scavenger, and is the precursor to the immunomodulatory protein, Gc-MAF. Vitamin D binding protein has been proposed to have significant roles in C5a chemotaxis, osteoclast development and possibly in macrophage activation/recruitment.

Publications

What published studies show

16922-1-AP is an anti-Vitamin D Binding Protein (VDBP) antibody with 15 total citations. Citations appear in journals including Advanced Science, Genes Discovery, Scientific Reports, Pharmaceutics, Gene Therapy, International Immunopharmacology, Molecular Medicine Reports, Molecular Therapy: Methods & Clinical Development, Journal of Inflammation Research, Journal of Nutrition, Proteomics, American Journal of Physiology, Experimental Eye Research, and BMC Ophthalmology. Research fields span neurology, oncology, immunology, cardiology, nephrology, infectious disease, endocrinology, ophthalmology, nutrition, and gene therapy.

Automatically generated from the 15 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Genes Dis; Vitamin D-binding protein in plasma microglia-derived extracellular vesicles as a potential biomarker for major depressive disorder; Authors - Gaojia Zhang
		Adv Sci (Weinh); Vitamin D Binding Protein, a Ligand of Integrin beta 1, Motivates Both Tumor Cells and Schwann Cells to Promote Perineural Invasion in Pancreatic Ductal Adenocarcinoma; Authors - Shan Zhang
mouse	WB	Adv Sci (Weinh); Microglia-Derived Vitamin D Binding Protein Mediates Synaptic Damage and Induces Depression by Binding to the Neuronal Receptor Megalin; Authors - Yan Kong
mouse	WB	Pharmaceutics; Evaluation of In Vitro and In Vivo Antiviral Activities of Vitamin D for SARS-CoV-2 and Variants; Authors - Chee-Keng Mok
mouse	WB	Gene Ther; Gene therapy of Dent disease type 1 in newborn ClC-5 null mice for sustained transgene expression and gene therapy effects; Authors - Pin Lyu
mouse	IHC	Int Immunopharmacol; Vitamin D attenuates DNCB-induced atopic dermatitis-like skin lesions by inhibiting immune response and restoring skin barrier function; Authors - Renwei Lu