Product Information
83727-2-PBS targets VEGF-C in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg32025 Product name: Recombinant Human VEGFC protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 103-227 aa of BC035212 Sequence: TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR Predict reactive species |
Full Name | vascular endothelial growth factor C |
Calculated Molecular Weight | 419 aa, 47 kDa |
GenBank Accession Number | BC035212 |
Gene Symbol | VEGFC |
Gene ID (NCBI) | 7424 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P49767 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |