Tested Applications
| Positive WB detected in | mouse heart tissue, MCF-7 cells, rat heart tissue |
| Positive IHC detected in | human lung cancer tissue, human heart tissue, human thyroid cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below |
| IHC | See 5 publications below |
| IF | See 4 publications below |
Product Information
26915-1-AP targets VEGFD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25552 Product name: Recombinant human FIGF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 90-128 aa of BC027948 Sequence: AATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKST Predict reactive species |
| Full Name | c-fos induced growth factor (vascular endothelial growth factor D) |
| Calculated Molecular Weight | 40 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC027948 |
| Gene Symbol | FIGF |
| Gene ID (NCBI) | 2277 |
| RRID | AB_2880683 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43915 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VEGFD is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for VEGFD antibody 26915-1-AP | Download protocol |
| WB protocol for VEGFD antibody 26915-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastric Cancer Cathepsin L promotes angiogenesis by regulating the CDP/Cux/VEGF-D pathway in human gastric cancer. | ||
Cereb Cortex Prolonged Consumption of Sweetened Beverages Lastingly Deteriorates Cognitive Functions and Reward Processing in Mice. | ||
Ann Transl Med Clostridium butyricum alleviates dextran sulfate sodium-induced experimental colitis and promotes intestinal lymphatic vessel regeneration in mice. | ||
BMC Complement Med Ther Effects of plant-based medicinal food on postoperative recurrence and lung metastasis of gastric cancer regulated by Wnt/β-catenin-EMT signaling pathway and VEGF-C/D-VEGFR-3 cascade in a mouse model | ||
Phytomedicine Calycosin inhibits triple-negative breast cancer progression through down-regulation of the novel estrogen receptor-α splice variant ER-α30-mediated PI3K/AKT signaling pathway |
