Tested Applications
Positive WB detected in | mouse heart tissue, MCF-7 cells, rat heart tissue |
Positive IHC detected in | human lung cancer tissue, human heart tissue, human thyroid cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 8 publications below |
IHC | See 5 publications below |
IF | See 4 publications below |
Product Information
26915-1-AP targets VEGFD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25552 Product name: Recombinant human FIGF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 90-128 aa of BC027948 Sequence: AATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKST Predict reactive species |
Full Name | c-fos induced growth factor (vascular endothelial growth factor D) |
Calculated Molecular Weight | 40 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC027948 |
Gene Symbol | FIGF |
Gene ID (NCBI) | 2277 |
RRID | AB_2880683 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O43915 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VEGFD is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for VEGFD antibody 26915-1-AP | Download protocol |
IHC protocol for VEGFD antibody 26915-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Gastric Cancer Cathepsin L promotes angiogenesis by regulating the CDP/Cux/VEGF-D pathway in human gastric cancer. | ||
Cereb Cortex Prolonged Consumption of Sweetened Beverages Lastingly Deteriorates Cognitive Functions and Reward Processing in Mice. | ||
Ann Transl Med Clostridium butyricum alleviates dextran sulfate sodium-induced experimental colitis and promotes intestinal lymphatic vessel regeneration in mice. | ||
BMC Complement Med Ther Effects of plant-based medicinal food on postoperative recurrence and lung metastasis of gastric cancer regulated by Wnt/β-catenin-EMT signaling pathway and VEGF-C/D-VEGFR-3 cascade in a mouse model | ||
Biochim Biophys Acta Mol Basis Dis WTAP promotes macrophage recruitment and increases VEGF secretion via N6-methyladenosine modification in corneal neovascularization |