VEGFR2/KDR Polyclonal antibody

• 

  WB analysis using 26415-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26415-1-AP (VEGFR2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 26415-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 26415-1-AP (VEGF Receptor 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 26415-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 26415-1-AP (VEGF Receptor 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of human placenta using 26415-1-AP

  IP result of anti-VEGFR2/KDR (IP:26415-1-AP, 4ug; Detection:26415-1-AP 1:3000) with human placenta tissue lysate 600 ug.

• 

  IP experiment of rat skeletal muscle using 26415-1-AP

  IP result of anti-VEGFR2/KDR (IP:26415-1-AP, 4ug; Detection:26415-1-AP 1:1000) with rat skeletal muscle tissue lysate 760 ug.

• 

  IHC staining of human placenta using 26415-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26415-1-AP (VEGFR2/KDR antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 26415-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26415-1-AP (VEGFR2/KDR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human placenta using 26415-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using VEGFR2/KDR antibody (26415-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human placenta using 26415-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using VEGFR2/KDR antibody (26415-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

VEGFR2/KDR Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 26415-1-AP

Publications(137)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF-P, IP, CoIP, ELISA

Synonyms

KDR, VEGFR2, CD309, EC:2.7.10.1, FLK-1

---

Tested Applications

• Positive WB detected in: human placenta tissue, mouse heart tissue, mouse lung tissue, mouse placenta tissue, rat lung tissue
• Positive IP detected in: human placenta tissue, rat skeletal muscle tissue
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 101 publications below
• IHC: See 19 publications below
• IF: See 37 publications below
• IP: See 2 publications below
• CoIP: See 2 publications below

Product Information

26415-1-AP targets VEGFR2/KDR in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, canine, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24589

  Product name: Recombinant human KDR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1158-1345 aa of BC131822

  Sequence: EHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQP

• Full Name: kinase insert domain receptor (a type III receptor tyrosine kinase)
• Calculated Molecular Weight: 1356 aa, 152 kDa
• Observed Molecular Weight: 150 kDa, 230 kDa
• GenBank Accession Number: BC131822
• Gene Symbol: KDR
• Gene ID (NCBI): 3791
• RRID: AB_2756527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35968
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KDR, also named as VEGFR-2, FLK1 and CD309, is a receptor for VEGF or VEGFC. KDR which belongs to the protein kinase superfamily, has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. KDR functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. Mutations of this gene are implicated in infantile capillary hemangiomas.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Bioact Mater; A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds; Authors - Shunlai Shang
human	IF	Sci Bull (Beijing); Restoring sweat gland function in mice using regenerative sweat gland cells derived from chemically reprogrammed human epidermal keratinocytes; Authors - Jiangbing Xiang
mouse	WB	J Exp Med; Secretogranin III as a disease-associated ligand for antiangiogenic therapy of diabetic retinopathy.; Authors - Michelle E LeBlanc
human	WB,IHC	Aging Dis; MSC-Derived Exosomes can Enhance the Angiogenesis of Human Brain MECs and Show Therapeutic Potential in a Mouse Model of Parkinson's Disease.; Authors - Chunling Xue
	WB,IF	J Neuroinflammation; Succinate-induced macrophage polarization and RBP4 secretion promote vascular sprouting in ocular neovascularization; Authors - Tianyi Shen
human	WB	Bioact Mater; Electrochemically derived nanographene oxide activates endothelial tip cells and promotes angiogenesis by binding endogenous lysophosphatidic acid.; Authors - Wenjing Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Poulomi (Verified Customer) (07-02-2024)

The blot was good. It detected VEGFR2 in brain endothelial cells and Hek cells.

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: Endothelial Cells

FH

Sammy (Verified Customer) (01-20-2024)

This works well to detect VEGFR2 in HUVEC lysate. Ab diluted in 3% BSA PBST.

• Applications: Western Blot
• Primary Antibody Dilution: 1 in 1000
• Cell Tissue Type: HUVEC

FH

Kyosuke (Verified Customer) (06-12-2019)

I am working on angiogenesis study and use this for WB on HUVECs. It works very well.

• Applications: Western Blot,
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: HUVECs