VHL Polyclonal antibody

• 

  WB analysis using 24756-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24756-1-AP (VHL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 24756-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24756-1-AP (VHL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24756-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24756-1-AP (VHL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 24756-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24756-1-AP (VHL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 24756-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24756-1-AP (VHL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 24756-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24756-1-AP (VHL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 24756-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24756-1-AP (VHL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 24756-1-AP

  Immunofluorescent analysis of HepG2 cells using 24756-1-AP (VHL antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

VHL Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24756-1-AP

Publications(22)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

HRCA1, Protein G7, pVHL, RCA1, VHL, VHL1

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, Raji cells
• Positive IHC detected in: human kidney tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 19 publications below
• IHC: See 2 publications below
• IF: See 3 publications below
• IP: See 1 publications below
• CoIP: See 2 publications below

Product Information

24756-1-AP targets VHL in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21447

  Product name: Recombinant human VHL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-172 aa of BC058831

  Sequence: NFDGEPQPYPTLPPGTGRRIYSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

• Full Name: von Hippel-Lindau tumor suppressor
• Calculated Molecular Weight: 172 aa, 20 kDa
• Observed Molecular Weight: 18-24 kDa
• GenBank Accession Number: BC058831
• Gene Symbol: VHL
• Gene ID (NCBI): 7428
• RRID: AB_2879705
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40337
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VHL (von Hippel-Lindau tumor suppressor) gene was identified as the tumor suppressor gene whose germ line mutations are associated with the inherited von Hippel-Lindau cancer syndrome (PMID: 8603073, 10722748). VHL patients develop a wide variety of tumors including retinal angioma, central nervous system hemangioblastoma, pheochromocytoma, and renal clear cell carcinoma (PMID: 10722748). VHL localizes predominantly to the cytoplasmic compartment but engages in a dynamic nuclear-cytoplasmic shuttle (PMID: 8700833, 9891082, 12101228). VHL has 3 isoforms with the molecular mass of 24, 20 and 18 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; Hypoxia-Induced LncRNA-MIR210HG Promotes Cancer Progression By Inhibiting HIF-1α Degradation in Ovarian Cancer.; Authors - Ping Liu
human	WB	Microvasc Res; A positive feedback loop between miR-574-3p and HIF-1α in promoting angiogenesis under hypoxia; Authors - Renwen Zhang
	CoIP	Cell Death Discov; Septin4 promotes cardiomyocytes apoptosis by enhancing the VHL-mediated degradation of HIF-1α.; Authors - Shaojun Wu
human	WB,CoIP	Pathol Oncol Res; MDM2 promotes cancer cell survival through regulating the expression of HIF-1α and pVHL in retinoblastoma; Authors - Shouhua Zhang
human	WB	EMBO J; A mitochondrial EglN1-AMPKα axis drives breast cancer progression by enhancing metabolic adaptation to hypoxic stress; Authors - Weiwei Jiang
human	IHC,WB	Cancer Res; Fatty Acid Oxidation Mediated by Malonyl-CoA Decarboxylase Represses Renal Cell Carcinoma Progression; Authors - Lijie Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

S (Verified Customer) (11-22-2021)

This antibody didn't work in my hands. There are too many non-specific bands to identify the VHL band.

• Applications: Western Blot

VHL Antibody Western Blot validation ( dilution) in (Cat no:24756-1-AP)