Vimentin Polyclonal antibody

• 

  WB analysis of HEK-293 using 22031-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 22031-1-AP (VIM antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22031-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22031-1-AP (Vimentin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 22031-1-AP

  WB result of Vimentin antibody (22031-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-Vimentin transfected A549 cells.

• 

  WB analysis of mouse heart using 22031-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 22031-1-AP (VIM antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of human kidney using 22031-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using Vimentin antibody (22031-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human kidney using 22031-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using Vimentin antibody (22031-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

Vimentin Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 22031-1-AP

Publications(24)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

VIM

---

Tested Applications

• Positive WB detected in: DU 145 cells, A549 cells, HEK-293 cells, mouse heart tissue, HeLa cells, Jurkat cells, rat heart tissue
• Positive IF-P detected in: human kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 18 publications below
• IHC: See 4 publications below
• IF: See 8 publications below

Product Information

22031-1-AP targets Vimentin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16898

  Product name: Recombinant human Vimentin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-86 aa of BC000163

  Sequence: MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDF

• Full Name: vimentin
• Calculated Molecular Weight: 466 aa, 54 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC000163
• Gene Symbol: VIM
• Gene ID (NCBI): 7431
• ENSEMBL Gene ID: ENSG00000026025
• RRID: AB_11182825
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08670
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vimentin, also named as VIM, belongs to the intermediate filament family. Vimentin is class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is important for stabilizing the architecture of the cytoplasm. Monocyte-derived macrophages secrete vimentin into the extracellular space in vitro. Secretion of vimentin was enhanced by the proinflammatory cytokine tumor necrosis factor-alpha (TNFA; 191160) and inhibited by the antiinflammatory cytokine IL10 (124092), suggesting that vimentin is involved in the immune response. Vimentin has specialized functions that contribute to specific dynamic cellular processes. As a phosphoprotein, 55-60 kDa of vimentin proteins can be observed due to the different phosphorylation level. Isoforms of vimentin (49 kDa and 60 kDa) had also been reported. (PMID: 8640945, 22728585).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Cell Death Dis; ZNF652 exerts a tumor suppressor role in lung cancer by transcriptionally downregulating cyclin D3; Authors - Chunfeng Xie
human	WB	J Transl Med; Single-cell and spatial transcriptome profiling reveal CTHRC1+ fibroblasts promote EMT through WNT5A signaling in colorectal cancer; Authors - Yunfei Lu
human	WB	Tissue Eng Part C Methods; Pretreatment with Inflammatory Factors Altered the Secretome of Human Amniotic Epithelial Cells; Authors - Wenjiao Cao
human	WB	Clin Respir J; SIRT3 Inhibits Cell Proliferation of Nonsmall Cell Lung Carcinoma by Inducing ROS Production; Authors - Ze Yu
mouse	IF	Biochim Biophys Acta Mol Basis Dis; A novel Cdc42-YAP-fibronectin signaling axis regulates ameloblast differentiation during early enamel formation; Authors - Jiayi Zhang
human	WB	Breast Cancer Res; SMYD4 promotes MYH9 ubiquitination through lysine monomethylation modification to inhibit breast cancer progression; Authors - Jin-Shuo Yang