Tested Applications
| Positive WB detected in | mouse kidney tissue, HEK-293 cells, rat kidney tissue |
| Positive IHC detected in | human breast cancer tissue, human cervical cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12804-1-AP targets VPS26A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3391 Product name: Recombinant human VPS26A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 41-327 aa of BC022505 Sequence: LFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM Predict reactive species |
| Full Name | vacuolar protein sorting 26 homolog A (S. pombe) |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC022505 |
| Gene Symbol | VPS26A |
| Gene ID (NCBI) | 9559 |
| RRID | AB_2215033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75436 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
In mammals, there are two paralogues of yeast Vps26, VPS26A and VPS26B (PMID: 16190980). VPS26 is a component of the retromer complex composed of VPS26 (VPS26A or VPS26B), VPS29, VPS35, SNX1, and SNX2. VPS26A and VPS26B subunits define distinct retromer complexes (PMID: 21920005). The retromer complex is important in recycling transmembrane receptors from endosomes to the trans-Golgi network (TGN).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VPS26A antibody 12804-1-AP | Download protocol |
| IHC protocol for VPS26A antibody 12804-1-AP | Download protocol |
| WB protocol for VPS26A antibody 12804-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VPS26A Polyclonal antibody (catalog number 12804-1-AP) has 10 citations. These appear in journals including Cell Metabolism, Autophagy, Nature Communications, Advanced Science, Science Advances, Cell Death & Disease, Annals of Neurology, International Journal of Molecular Sciences, bioRxiv, and eLife. The research fields span retromer complex function, autophagy, neurodegeneration (Parkinson's disease, Down syndrome, brain aging), lysosomal mtDNA turnover, intestinal barrier dysfunction in inflammatory bowel disease, pulmonary fibrosis, and pancreatic adenocarcinoma. Applications include Western blot, immunofluorescence, and immunohistochemistry, primarily in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Cell Metab Phospholipase PLA2G6, a Parkinsonism-Associated Gene, Affects Vps26 and Vps35, Retromer Function, and Ceramide Levels, Similar to α-Synuclein Gain. | ||
Autophagy RAB21 controls autophagy and cellular energy homeostasis by regulating retromer-mediated recycling of SLC2A1/GLUT1 | ||
Adv Sci (Weinh) Loss of VMP1 Impairs Tight Junction Recycling and Aggravates Intestinal Barrier Dysfunction in Inflammatory Bowel Disease. | ||
Cell Death Dis Targeting sorting nexin 3 to treat pulmonary fibrosis by dual modulating Wnt/β-catenin signaling. |
Reviews
What customers say
Both reviewers rated the antibody 4 out of 5 stars. One user performed Western blot on mouse brain lysate at 1:2000 dilution and confirmed detection of endogenous VPS26A, though some non-specific bands were observed. The other user used the antibody at 1:300 for immunofluorescence on mouse OC2 cells, co-staining with DAPI and Phalloidin-647 to visualize DNA and F-actin, reporting successful staining. Overall, the antibody performs well for both WB and IF applications on mouse samples, with minor non-specific binding noted in one WB experiment.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xin (Verified Customer) (10-10-2022) | It is Ok to detect endogenous VPS26A although there are some non-specific bands.
 |
Stephen (Verified Customer) (09-07-2019) | Oc-2 cells fixed with 4% PFA Perm. by 0.3% tx100 for 5 min blocked with 1% BSA in 1XPBS for 2 hours vps26a antibody incubated 1:300 overnight at 4 degrees in 1%BSA in 1x PBS. Co-stained with DAPI (blue) and Ph647 (red) to visualize DNA and F-actin respectively.
 |
