Tested Applications
| Positive WB detected in | HEK-293 cells, rat skeletal muscle tissue, mouse skeletal muscle, Jurkat cells, U-87 cells |
| Positive IP detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | human colon tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13676-1-AP targets WDR1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4670 Product name: Recombinant human WDR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC030541 Sequence: MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG Predict reactive species |
| Full Name | WD repeat domain 1 |
| Calculated Molecular Weight | 606 aa, 66 kDa |
| Observed Molecular Weight | 66-70 kDa |
| GenBank Accession Number | BC030541 |
| Gene Symbol | WDR1 |
| Gene ID (NCBI) | 9948 |
| RRID | AB_10697831 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75083 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WDR1, which belongs to the WD repeat AIP1 family, also known as AIP1, is a 606 amino acid protein that localizes to the cytoskeleton. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WDR1 induces the disassembly of actin filaments in conjunction with ADF/cofilin family proteins (PMID:15629458, 27557945, 29751004). WDR1 mutations may impair the ability of WDR1 to regulate cofilin-mediated actin depolymerization, and are associated with periodic fever, immunodeficiency, and thrombocytopenia syndrome (PMID: 27557945,27994071,29751004).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for WDR1 antibody 13676-1-AP | Download protocol |
| IP protocol for WDR1 antibody 13676-1-AP | Download protocol |
| WB protocol for WDR1 antibody 13676-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The WDR1 Polyclonal antibody (Cat# 13676-1-AP) has 11 total citations published in journals including Cell Death & Disease, International Journal of Biological Sciences, Molecular Cells, Frontiers in Immunology, American Journal of Pathology, Journal of Biological Chemistry, Experimental Biology and Medicine, Cerebral Cortex, Gene, Developmental Biology, and International Journal of Clinical and Experimental Pathology. Research fields span actin cytoskeleton dynamics, cancer biology, cardiac development and function, embryonic development, and neuroscience.
| Species | Application | Title |
|---|---|---|
Cell Death Dis AIP1-mediated actin disassembly is required for postnatal germ cell migration and spermatogonial stem cell niche establishment. | ||
Int J Biol Sci WDR1 Promotes Cell Growth and Migration and Contributes to Malignant Phenotypes of Non-small Cell Lung Cancer through ADF/cofilin-mediated Actin Dynamics.
| ||
Mol Cells WD Repeat Domain 1 Deficiency Inhibits Neointima Formation in Mice Carotid Artery by Modulation of Smooth Muscle Cell Migration and Proliferation.
| ||
Front Immunol Systematic pan-cancer analysis reveals context-dependent prognostic and immunological roles of WDR1 with divergent effects in renal and gastric cancers. | ||
Am J Pathol A Cardiomyocyte-Specific Wdr1 Knockout Demonstrates Essential Functional Roles for Actin Disassembly during Myocardial Growth and Maintenance In Mice.
| ||
J Biol Chem Trp-Asp (WD) repeat domain 1 is Essential for Mouse Peri-implantation Development and Regulates Cofilin Phosphorylation. |
