WDR6 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 20508-1-AP (same clone as 20508-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20508-1-AP (WDR6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20508-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 20508-1-AP (same clone as 20508-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20508-1-AP (WDR6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20508-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 20508-1-AP (same clone as 20508-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 20508-1-AP (WDR6 antibody) at dilution of 1:50 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20508-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20508-1-AP (same clone as 20508-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using WDR6 antibody 20508-1-AP at 1:25 dilution and FITC- labeled goat anti-Rabbit IgG (green). This data was developed using the same antibody clone with 20508-1-PBS in a different storage buffer formulation.

WDR6 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20508-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20508-1-PBS targets WDR6 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14316

  Product name: Recombinant human WDR6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 833-1121 aa of BC002826

  Sequence: MHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD

• Full Name: WD repeat domain 6
• Calculated Molecular Weight: 1121 aa, 122 kDa
• Observed Molecular Weight: 122 kDa
• GenBank Accession Number: BC002826
• Gene Symbol: WDR6
• Gene ID (NCBI): 11180
• RRID: AB_10732597
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NNW5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.