WDR69 Polyclonal antibody

• 

  WB analysis using 26329-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26329-1-AP (WDR69 antibody) at dilution of 1:12000 incubated at room temperature for 1.5 hours.

WDR69 Polyclonal Antibody for WB, ELISA

Cat No. 26329-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

WD repeat domain 69, WDR69

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26329-1-AP targets WDR69 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23664

  Product name: Recombinant human WDR69 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-325 aa of BC036377

  Sequence: MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRLQEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADG

• Full Name: WD repeat domain 69
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC036377
• Gene Symbol: WDR69
• Gene ID (NCBI): 164781
• RRID: AB_3085858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N136
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.