WNK3 Polyclonal antibody

• 

  WB analysis using 32231-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32231-1-AP (WNK3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

WNK3 Polyclonal Antibody for WB, ELISA

Cat No. 32231-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Serine/threonine-protein kinase WNK3, Protein kinase with no lysine 3, Protein kinase lysine-deficient 3, PRKWNK3, KIAA1566

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HEK-293T cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32231-1-AP targets WNK3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37713

  Product name: Recombinant mouse WNK3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 500-650 aa of NM_001002838

  Sequence: AGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQST

• Full Name: WNK lysine deficient protein kinase 3
• Calculated Molecular Weight: 1800aa, 198 kDa
• Observed Molecular Weight: 230 kDa
• GenBank Accession Number: NM_001002838
• Gene Symbol: WNK3
• Gene ID (NCBI): 65267
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BYP7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WNK3, is a member of the WNK (With No Lysine [K]) kinase family. It is a serine/threonine kinase that plays important roles in various physiological processes. WNK3 is expressed in brain, lung, kidney, liver and pancreas, and in fetal tissues including placenta, fetal brain, lung and kidney. Very low levels of expression were also detected in fetal heart, thymus, liver and spleen. Isoform 1 is brain-specific. Isoform 3 is kidney-specific. Endogenous WNK3 protein is an active protein kinase when immunoprecipitated from cells and its overexpression increases the survival of HeLa cells by delaying the onset of apoptosis (PMID:16501604).