Product Information
66432-1-Ig targets WNT1 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25463 Product name: Recombinant human WNT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 106-197 aa of BC074799 Sequence: TAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFL Predict reactive species |
Full Name | wingless-type MMTV integration site family, member 1 |
Observed Molecular Weight | 41 kDa |
GenBank Accession Number | BC074799 |
Gene Symbol | WNT1 |
Gene ID (NCBI) | 7471 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P04628 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WNT1 is a member of the WNT gene family. WNT1 have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome.