WNT1 Monoclonal antibody

WNT1 Monoclonal Antibody for ELISA
Cat No. 66432-1-Ig
Clone No.1E3C10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

ELISA

INT1, Proto oncogene Int 1 homolog, Proto oncogene Wnt 1, WNT1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66432-1-Ig targets WNT1 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25463

Product name: Recombinant human WNT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 106-197 aa of BC074799

Sequence: TAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFL

Predict reactive species
Full Name wingless-type MMTV integration site family, member 1
Observed Molecular Weight 41 kDa
GenBank Accession NumberBC074799
Gene Symbol WNT1
Gene ID (NCBI) 7471
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04628
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WNT1 is a member of the WNT gene family. WNT1 have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. 

Loading...
||
New chat Able
正在加载,请稍候...