Tested Applications
| Positive WB detected in | fetal human brain tissue, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26744-1-AP targets WNT3A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25051 Product name: Recombinant human WNT3A protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 250-350 aa of BC103921 Sequence: RGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT Predict reactive species |
| Full Name | wingless-type MMTV integration site family, member 3A |
| Calculated Molecular Weight | 352 aa, 39 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC103921 |
| Gene Symbol | WNT3A |
| Gene ID (NCBI) | 89780 |
| RRID | AB_2918108 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P56704 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WNT3A belongs to wingless-type MMTV integration site family, and abnormal Wnt signalling is often associated with severe human diseases, including cancer, osteoporosis and other degenerative disorders. WNT3A is a secreted glycoprotein that is involved in both canonical and non-canonical Wnt signaling pathways. The canonical Wnt pathway, also known as the β-catenin-dependent pathway, regulates gene expression by stabilizing β-catenin, which then translocates to the nucleus and interacts with transcription factors like TCF/LEF. It's shown to promote trophectoderm formation in embryonic stem cells. It's reported that the canonical Wnt/β-catenin signaling pathway also contributes to the carcinogenesis and progression of lung cancer cell lines. The non-canonical pathways, which are β-catenin-independent, are involved in cytoskeletal organization and cell polarity.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for WNT3A antibody 26744-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The WNT3A Polyclonal antibody (Cat# 26744-1-AP) has 82 citations. These appear in journals including Nature, Bioact Mater, Autophagy, ACS Nano, Advanced Science, Science Advances, Phytomedicine, EMBO Molecular Medicine, Journal of Translational Medicine, Apoptosis, Life Sciences, Journal of Bone Oncology, Oncology Reports, and PLoS One, among others. Research fields span Wnt/β-catenin signaling, cancer (colorectal, gastric, lung, breast, ovarian, esophageal), bone regeneration, cardiovascular disease, neurodegeneration, fibrosis, and metabolic disorders.
| Species | Application | Title |
|---|---|---|
Bioact Mater Magnesium ion implantation enhances the osseointegration and vascularization of 3D-Printed CoCrMo alloy scaffolds for load-bearing orthopedic applications. | ||
Autophagy WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway. | ||
ACS Nano Flowerbed-Inspired Mg-Loaded Scaffold Accelerates Critical-Sized Bone-Defect Repair by Reprogramming the Microenvironment. | ||
Adv Sci (Weinh) CHB-Induced Immune Zonation Chaos Elicited LXRα-mediated Lipid Metabolism Disorders in Kupffer Cells to Induce Cancer Stem Cell Formation. | ||
Adv Sci (Weinh) Photothermal Coating on Zinc Alloy for Controlled Biodegradation and Improved Osseointegration |
