• Featured Product
  • KD/KO Validated

WWOX Polyclonal antibody

WWOX Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 15299-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

D16S432E, FOR, FRA16D, HHCMA56, PRO0128, SDR41C1, WOX1, WWOX

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, MCF-7 cells, mouse skeletal muscle tissue, mouse kidney tissue, mouse liver tissue, mouse testis tissue
Positive IP detected inmouse skeletal muscle tissue
Positive IHC detected inhuman liver cancer tissue, mouse liver tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15299-1-AP targets WWOX in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7555

Product name: Recombinant human WWOX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-234 aa of BC003184

Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG

Predict reactive species
Full Name WW domain containing oxidoreductase
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC003184
Gene Symbol WWOX
Gene ID (NCBI) 51741
RRIDAB_2216389
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NZC7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WWOX(WW domain-containing oxidoreductase) is also named as FOR, WOX1 and belongs to the short-chain dehydrogenases/reductases (SDR) family. The gene encodes a 46 kDa protein that contains two WW domains and a short-chain dehydrogenase/reductase domain and the protein is lost or reduced in the majority of many cancer types including breast, prostate, esophageal, lung, stomach, and pancreatic carcinomas and in a large fraction of other cancer types(PMID:17360458). WWOX behaves as a potential tumor-suppressor gene(PMID:15064722). It has 7 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IHC protocol for WWOX antibody 15299-1-APDownload protocol
IP protocol for WWOX antibody 15299-1-APDownload protocol
WB protocol for WWOX antibody 15299-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Hum Mutat

Early infantile onset epileptic encephalopathy 28 due to a homozygous microdeletion involving the WWOX gene in a region of uniparental disomy.

Authors - Mariska Davids
humanWB,IHC

Front Oncol

WWOX-rs13338697 genotype predicts therapeutic efficacy of ADI-PEG 20 for patients with advanced hepatocellular carcinoma

Authors - Yu-De Chu
  • KD Validated
humanWB

Molecules

Evodiamine Exerts an Anti-Hepatocellular Carcinoma Activity through a WWOX-Dependent Pathway.

Authors - Che-Yuan Hu
humanWB

Int J Mol Med

WWOX induces apoptosis and inhibits proliferation in cervical cancer and cell lines.

Authors - Qu Junjie J
  • KD Validated
humanIHC

Oncol Lett

Expression and clinical significance of WWOX, Elf5, Snail1 and EMT related factors in epithelial ovarian cancer.

Authors - Yakun Hu
humanWB

Int J Cancer

Remote modulation of WWOX by an intronic variant associated with survival of Chinese gastric cancer patients

Authors - Lei Cheng
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...