WWOX Polyclonal antibody

• 

  WB analysis using 15299-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15299-1-AP (WWOX antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 15299-1-AP

  WB result of WWOX antibody (15299-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-WWOX transfected MCF-7 cells.

• 

  WB analysis of mouse skeletal muscle using 15299-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15299-1-AP (WWOX antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 15299-1-AP

  IP result of anti-WWOX (IP:15299-1-AP, 4ug; Detection:15299-1-AP 1:500) with mouse skeletal muscle tissue lysate 4000ug.

• 

  IHC staining of human liver cancer using 15299-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15299-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 15299-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 15299-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 15299-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 15299-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

WWOX Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 15299-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

D16S432E, FOR, FRA16D, HHCMA56, PRO0128, SDR41C1, WOX1, WWOX

---

Tested Applications

• Positive WB detected in: HepG2 cells, MCF-7 cells, mouse skeletal muscle tissue, mouse kidney tissue, mouse liver tissue, mouse testis tissue
• Positive IP detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human liver cancer tissue, mouse liver tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

15299-1-AP targets WWOX in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7555

  Product name: Recombinant human WWOX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC003184

  Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG

• Full Name: WW domain containing oxidoreductase
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC003184
• Gene Symbol: WWOX
• Gene ID (NCBI): 51741
• RRID: AB_2216389
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZC7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WWOX(WW domain-containing oxidoreductase) is also named as FOR, WOX1 and belongs to the short-chain dehydrogenases/reductases (SDR) family. The gene encodes a 46 kDa protein that contains two WW domains and a short-chain dehydrogenase/reductase domain and the protein is lost or reduced in the majority of many cancer types including breast, prostate, esophageal, lung, stomach, and pancreatic carcinomas and in a large fraction of other cancer types(PMID:17360458). WWOX behaves as a potential tumor-suppressor gene(PMID:15064722). It has 7 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Hum Mutat; Early infantile onset epileptic encephalopathy 28 due to a homozygous microdeletion involving the WWOX gene in a region of uniparental disomy.; Authors - Mariska Davids
human	WB,IHC	Front Oncol; WWOX-rs13338697 genotype predicts therapeutic efficacy of ADI-PEG 20 for patients with advanced hepatocellular carcinoma; Authors - Yu-De Chu ; KD Validated
human	WB	Molecules; Evodiamine Exerts an Anti-Hepatocellular Carcinoma Activity through a WWOX-Dependent Pathway.; Authors - Che-Yuan Hu
human	WB	Int J Mol Med; WWOX induces apoptosis and inhibits proliferation in cervical cancer and cell lines.; Authors - Qu Junjie J ; KD Validated
human	IHC	Oncol Lett; Expression and clinical significance of WWOX, Elf5, Snail1 and EMT related factors in epithelial ovarian cancer.; Authors - Yakun Hu
human	WB	Int J Cancer; Remote modulation of WWOX by an intronic variant associated with survival of Chinese gastric cancer patients; Authors - Lei Cheng ; KD Validated