ZADH2 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 14679-1-AP (same clone as 14679-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14679-1-AP (ZADH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14679-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 14679-1-AP (same clone as 14679-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14679-1-AP (ZADH2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14679-1-AP (same clone as 14679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14679-1-AP (ZADH2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14679-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 14679-1-AP (same clone as 14679-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14679-1-AP (ZADH2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14679-1-PBS in a different storage buffer formulation.

ZADH2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14679-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14679-1-PBS targets ZADH2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6390

  Product name: Recombinant human ZADH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-377 aa of BC078661

  Sequence: MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPHSVNSKL

• Full Name: zinc binding alcohol dehydrogenase domain containing 2
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC078661
• Gene Symbol: ZADH2
• Gene ID (NCBI): 284273
• RRID: AB_2218521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N4Q0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.