ZBTB25 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse testis using 25631-1-AP (same clone as 25631-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25631-1-AP (ZBTB25 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 25631-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 25631-1-AP (same clone as 25631-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25631-1-AP (ZBTB25 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25631-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 25631-1-AP (same clone as 25631-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 25631-1-AP (ZBTB25 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 25631-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 25631-1-AP (same clone as 25631-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 25631-1-AP (ZBTB25 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25631-1-PBS in a different storage buffer formulation.

ZBTB25 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25631-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25631-1-PBS targets ZBTB25 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22507

  Product name: Recombinant human ZBTB25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 154-435 aa of BC035804

  Sequence: NSGNRAAVQGDHPQLQLSLAIGLDDGTADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFTENSVKIHLCHYCGERFDSRSNLRQHLHTHVSGSLPFGVPASILESNDLGEVHPLNENSEALECRRLSSFIVKENEQQPDHTNRGTTEPLQISQVSLISKDTEPVELNCNFSFSRKRKMSCTICGHKFPRKSQLLEHMYTHKGKSYRYNRCQRFGNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILVE

• Full Name: zinc finger and BTB domain containing 25
• Calculated Molecular Weight: 435 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC035804
• Gene Symbol: ZBTB25
• Gene ID (NCBI): 7597
• RRID: AB_2880171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24278
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.