ZBTB46 Polyclonal antibody

• 

  WB analysis of RAW 264.7 using 25455-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 25455-1-AP (ZBTB46 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skin using 25455-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 25455-1-AP (ZBTB46 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 25455-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 25455-1-AP (ZBTB46 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ZBTB46 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25455-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Zinc finger and BTB domain-containing protein 46, RINZF, BZEL, BTB-ZF protein expressed in effector lymphocytes, BTBD4

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells
• Positive IHC detected in: mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25455-1-AP targets ZBTB46 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22273

  Product name: Recombinant human ZBTB46 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-416 aa of BC073800

  Sequence: ELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGGSELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVRHITQQVEDDSRASSPVPSFLPTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRK

• Full Name: zinc finger and BTB domain containing 46
• Calculated Molecular Weight: 589 aa, 64 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC073800
• Gene Symbol: ZBTB46
• Gene ID (NCBI): 140685
• RRID: AB_2880088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UZ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZBTB46, also named as BTBD4, ZNF340, is a 589 amino acid protein, which contains one BTB (POZ) domain and two C2H2-type zinc fingers. ZBTB46 functions as a transcriptional repressor for PRDM1.