ZBTB46 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZBTB46 Polyclonal antibody (25455-1-AP)

ZBTB46 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25455-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Zinc finger and BTB domain-containing protein 46, RINZF, BZEL, BTB-ZF protein expressed in effector lymphocytes, BTBD4

• 

  WB analysis of RAW 264.7 using 25455-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 25455-1-AP (ZBTB46 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 25455-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 25455-1-AP (ZBTB46 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 25455-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 25455-1-AP (ZBTB46 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZBTB46 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells
• Positive IHC detected in: mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25455-1-AP targets ZBTB46 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22273

  Product name: Recombinant human ZBTB46 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-416 aa of BC073800

  Sequence: ELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGGSELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVRHITQQVEDDSRASSPVPSFLPTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRK

• Full Name: zinc finger and BTB domain containing 46
• Calculated Molecular Weight: 589 aa, 64 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC073800
• Gene Symbol: ZBTB46
• Gene ID (NCBI): 140685
• RRID: AB_2880088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UZ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZBTB46, also named as BTBD4, ZNF340, is a 589 amino acid protein, which contains one BTB (POZ) domain and two C2H2-type zinc fingers. ZBTB46 functions as a transcriptional repressor for PRDM1.

Publications

What published studies show

The ZBTB46 Polyclonal antibody (Cat# 25455-1-AP) has 1 citation to date. The cited publication appeared in Frontiers in Immunology (2025), where the antibody was used for Western blot in mouse samples. The research focuses on immunology and oncology, specifically investigating how FLT3L combined with GM-CSF–induced dendritic cells drive tumor-specific CD8+ T cell responses and remodel the tumor microenvironment to enhance anti-tumor efficacy.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Immunol; FLT3L combined with GM-CSF induced dendritic cells drive broad tumor-specific CD8+ T cell responses and remodel the tumor microenvironment to enhance anti-tumor efficacy; Authors - Qian Zheng