ZBTB48 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86981-6-RR (same clone as 86981-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86981-6-RR (ZBTB48 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86981-6-PBS in a different storage buffer formulation.

• 

  Affinity of 86981-6-RR

  Biolayer interferometry (BLl) kinetic assays of 86981-6-RR against Human ZBTB48 were performed. The affinity constant is 0.588 nM.

ZBTB48 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86981-6-PBS

Clone No.252100E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

TZAP, HKR3, Krueppel-related zinc finger protein 3, pp9964, Protein HKR3

---

Product Information

86981-6-PBS targets ZBTB48 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20301

  Product name: Recombinant human ZBTB48 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-293 aa of BC013573

  Sequence: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEPAENRKGTAVPVEC

• Full Name: zinc finger and BTB domain containing 48
• Calculated Molecular Weight: 688 aa, 77 kDa
• GenBank Accession Number: BC013573
• Gene Symbol: ZBTB48
• Gene ID (NCBI): 3104
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10074
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZBTB48, also named as TZAP and HKR3, is a 688 amino acid protein, which contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB48 is detected in adrenal gland and neuroblastoma. ZBTB48 binds to and regulates the J and/or S elements in MHC II promoter. Zinc finger and BTB domain containing 48 (ZBTB48), also known as telomeric zinc-finger associated protein (TZAP), is a protein that triggers the trimming of telomeres in the absence of shelterin. ZBTB48, is a relatively uncharacterized POK family protein with a POZ-domain and 11 zinc finger domains. ZBTB48, is ubiquitously expressed in human tissues. The ZBTB48 gene is mapped to human chromosome 1p36, which is commonly rearranged (leiomyoma and leukemias) or deleted in various cancers (neuroblastoma, melanoma, Merkel cell carcinomas, pheochromocytoma and breast and colon carcinomas. A correlation between deletions or rearrangements of HKR3 and human cancer suggest a role for ZBTB48 as a potential tumor suppressor.