Tested Applications
| Positive WB detected in | COLO 320 cells, MCF-7 cells, PC-3 cells, Jurkat cells, MDA-MB-453s cells, mouse colon tissue, HeLa cells |
| Positive IP detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21544-1-AP targets ZEB1 in WB, IHC, IF, IP, CoIP, ChIP, ELISA, CUT&RUN applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16204 Product name: Recombinant human ZEB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 391-740 aa of BC112392 Sequence: MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSL Predict reactive species |
| Full Name | zinc finger E-box binding homeobox 1 |
| Calculated Molecular Weight | 1125 aa, 124 kDa |
| Observed Molecular Weight | 190-210 kDa |
| GenBank Accession Number | BC112392 |
| Gene Symbol | ZEB1 |
| Gene ID (NCBI) | 6935 |
| RRID | AB_10734325 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P37275 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ZEB1(zinc-finger-enhancer binding protein 1), which is a member of the Zinc finger-Homeobox (ZFH) family of repressors, acts as a transcriptional repressor that inhibits interleukin-2 (IL-2) gene expression. Depending on the quantity of cDNA and on the cell type, ZEB1 can enhance or repress the promoter activity of the ATP1A1 gene. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. The calculated molecular weight of ZEB1 is 124 kDa, but the post-phosphorylation of protein is about 190-210 kDa. This is a rabbit polyclonal antibody raised against part of the full length of ZEB1 of human.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for ZEB1 antibody 21544-1-AP | Download protocol |
| WB protocol for ZEB1 antibody 21544-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ZEB1 Polyclonal antibody (Cat# 21544-1-AP) has accumulated 339 citations. Publications appear in high-impact journals including Cell, Nature Communications, Gastroenterology, Cancer Research, Oncogene, EMBO Journal, and Cell Death & Disease. Research fields span epithelial-mesenchymal transition (EMT), cancer metastasis, hepatocellular carcinoma, breast cancer, pancreatic cancer, glioblastoma, ferroptosis, immune regulation, fibrosis, and stem cell biology. The antibody is predominantly used in Western blot, with additional applications in IHC, ChIP, IF, and IP.
| Species | Application | Title |
|---|---|---|
J Hematol Oncol LincK contributes to breast tumorigenesis by promoting proliferation and epithelial-to-mesenchymal transition. | ||
Gastroenterology Cancer-associated endocrine cells participate in pancreatic carcinogenesis | ||
Cancer Commun (Lond) YB1 regulates miR-205/200b-ZEB1 axis by inhibiting microRNA maturation in hepatocellular carcinoma. | ||
Cancer Res Super-Enhancer-Associated Long Noncoding RNA HCCL5 Is Activated by ZEB1 and Promotes the Malignancy of Hepatocellular Carcinoma. | ||
Nat Commun Long non-coding RNA NR2F1-AS1 induces breast cancer lung metastatic dormancy by regulating NR2F1 and ΔNp63. |
Reviews
What customers say
All three reviewers rated the antibody 4–5 stars. Two used it for Western blotting (at 1:1000 and 1:2000 dilution) and reported clear, expected-molecular-weight Zeb1 bands with minimal non-specific binding. The third reviewer confirmed strong performance in immunoprecipitation. Overall, users highlight reliable specificity, clean bands, and consistent results across applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Yussuf (Verified Customer) (12-25-2025) | Performed really well in an IP.
|
Kathryn (Verified Customer) (10-14-2021) | Antibody worked really well first time and produced clear Zeb1 bands at the MW expected, with barely any non specific binding.
|
K (Verified Customer) (12-20-2020) | I used tis Ab for western blotting at 1:2000 dilution and got good results.
|
