ZFP161 / ZBTB14 Polyclonal antibody

• 

  WB analysis using 22056-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22056-1-AP (ZFP161 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

ZFP161 / ZBTB14 Polyclonal Antibody for WB, ELISA

Cat No. 22056-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

hZF5, ZBTB14, ZF5, Zfp 161, Zfp 5, ZFP161, Zinc finger protein 5 homolog, ZNF478

---

Tested Applications

• Positive WB detected in: HEK-293 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

22056-1-AP targets ZFP161 / ZBTB14 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17082

  Product name: Recombinant human ZFP161 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 103-449 aa of BC110519

  Sequence: EDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS

• Full Name: zinc finger protein 161 homolog (mouse)
• Calculated Molecular Weight: 449 aa, 51 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC110519
• Gene Symbol: ZFP161
• Gene ID (NCBI): 7541
• RRID: AB_3085683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43829
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZBTB14, also named as :ZFP161, ZNF478, is a 449 amino acid protein, which interacts with ZBTB21. ZBTB14, is a transcriptional activator of the dopamine transporter (DAT), binding it's promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. ZBTB14 Binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene. The calculated MW of ZFP161 is 52 kDa, 22056-1-AP can detect a band around 55 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Adv Res; Transducin-like enhancer of split 3 protects against lipopolysaccharide-induced inflammation through DDX5-ATF1-PPP2R5A signaling; Authors - Di Fan