ZFP36L2 Polyclonal antibody, PBS Only

• 

  WB analysis using 30640-1-AP (same clone as 30640-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30640-1-AP (ZFP36L2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30640-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 30640-1-AP (same clone as 30640-1-PBS)

  WB result of ZFP36L2 antibody (30640-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZFP36L2 transfected HL-60 cells. This data was developed using the same antibody clone with 30640-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 30640-1-AP (same clone as 30640-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30640-1-AP (ZFP36L2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30640-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 30640-1-AP (same clone as 30640-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using ZFP36L2 antibody (30640-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30640-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 30640-1-AP (same clone as 30640-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using ZFP36L2 antibody (30640-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30640-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZFP36L2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30640-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

BRF2, Butyrate response factor 2, EGF response factor 2, EGF-response factor 2, ERF 2

---

Product Information

30640-1-PBS targets ZFP36L2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32428

  Product name: Recombinant human ZFP36L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 292-482 aa of BC005010

  Sequence: SCSSASSCSSSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGTGGAEDLLAPGAPCAACSSASCANNAFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQQQQGLAPPAQPPAPPSATLPAGAAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDP

• Full Name: zinc finger protein 36, C3H type-like 2
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC005010
• Gene Symbol: ZFP36L2
• Gene ID (NCBI): 678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47974
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZFP36L2 (Zinc finger protein 36 like 2) is an RNA-binding protein, belonging to the ZFP36 family, which regulates gene expression at the post-transcriptional level by binding and destabilizing certain AU-rich element (ARE) located in the 3′ untranslated regions (3′UTRs) of mRNA (PMID: 29518627). Moreover, ZFP36L2 is a key protein that controls S-phase progression in the case of genome instability (PMID: 29449217).